KEGG   Homo sapiens (human): 7201Help
Entry
7201              CDS       T01001                                 

Gene name
TRHR, TRH-R
Definition
(RefSeq) thyrotropin releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H01700  Hypopituitarism
Drug target
Montirelin (DG01347): D02588 D09845
Protirelin (DG01171): D00176 D02007
Rovatirelin hydrate: D10594
Taltirelin hydrate: D01925
Thyrotropin alfa: D06120
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7201 (TRHR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7201 (TRHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Thyrotropin-releasing hormone
    7201 (TRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 7201
NCBI-ProteinID: NP_003292
OMIM: 188545
HGNC: 12299
Ensembl: ENSG00000174417
Vega: OTTHUMG00000164910
Pharos: P34981(Tclin)
UniProt: P34981
Position
8q23.1
AA seq 398 aa AA seqDB search
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES
DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgagacagtcagtgaactgaaccaaacacagcttcagccacgagcagtggtg
gccttagaataccaggtggtcaccatcttacttgtactcattatttgtggcctgggcatt
gtaggcaacatcatggtagtcctggttgtcatgagaaccaagcacatgaggacccccaca
aactgctacctggtgagcctggcagtagctgatctcatggtcttggtggccgcaggcctc
cccaacataacagacagtatctacggttcctgggtctatggctatgttggatgcctctgc
attacttacctccagtatttgggaattaatgcatcctcttgttcaataacagcctttacc
attgagaggtacatagcaatctgtcaccccatcaaagcccagtttctctgcacattttcc
agagccaaaaagattatcatctttgtctgggctttcacatctctttactgtatgctctgg
ttcttcttgctggatctcaatattagcacctacaaagatgctattgtgatatcctgtggc
tacaagatctccaggaattactactcacctatttacctaatggactttggtgtcttttat
gttgtgccaatgatcctggctaccgtcctctatggattcatagctagaatccttttctta
aatcccattccttcagatcctaaagaaaactctaagacatggaaaaatgattcaacccat
cagaacacaaatctgaatgtaaatacctctaatagatgtttcaacagcacagtatcttca
aggaagcaggtcaccaagatgctggcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactctagtggttgtcaactcatttctctccagtcctttccaagaaaattgg
tttttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccggtgatttac
aatctcatgtcccagaaattccgtgcagccttcagaaagctctgcaactgcaagcagaag
ccaacagagaaacctgctaactacagtgtggccctaaattacagcgtcatcaaggagtca
gaccatttcagcacagagcttgatgatatcactgtcactgacacttacctgtctgccaca
aaagtgtcttttgatgacacctgcttggcttctgaggtatcctttagccaaagttga

DBGET integrated database retrieval system