KEGG   Homo sapiens (human): 7205Help
Entry
7205              CDS       T01001                                 

Gene name
TRIP6, OIP-1, OIP1, TRIP-6, TRIP6i2, ZRP-1
Definition
thyroid hormone receptor interactor 6
Orthology
K12792  
thyroid receptor-interacting protein 6
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7205 (TRIP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22
AA seq 476 aa AA seqDB search
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcccacctggctgcccccgaagcagccggagcccgccagagcccctcagggg
agggcgatcccccgcggcaccccggggccaccaccggcccacggagcagcactccagccc
caccccagggtcaatttttgcccccttccatctgagcagtgttaccaggccccaggggga
ccggaggatcgggggccggcgtgggtggggtcccatggagtactccagcacacgcagggg
ctccctgcagacagggggggccttcgccctggaagcctggacgccgagatagacttgctg
agcagcacgctggccgagctgaatgggggtcggggtcatgcgtcacggcgaccagaccga
caggcatatgagcccccgccacctcctgcctaccgcacgggctccctgaagccaaatcca
gcctcgccgctcccagcgtctccctatgggggccccactccagcctcttacactaccgcc
agcaccccggctggcccagccttccccgtgcaagtgaaggtggcacagccagtgaggggc
tgcggcccacccaggcggggagcctctcaggcctctgggcccctcccgggcccccacttt
cctctcccaggccgaggtgaagtctgggggcctggctataggagccagagagagccaggg
ccaggggccaaagaggaagctgctggggtctctggccctgcaggaagaggaagaggaggc
gagcacgggccccaggtgcccctgagccagcctccagaggatgagctggataggctgacg
aagaagctggttcacgacatgaaccacccgcccagcggggagtactttggccagtgtggt
ggctgcggagaagatgtggttggggatggggctggggttgtggcccttgatcgcgtcttt
cacgtgggctgctttgtatgttctacatgccgggcccagcttcgcggccagcatttctac
gccgtggagaggagggcatattgcgagggctgctacgtggccaccctggagaaatgtgcc
acgtgctcccagcccatcctggaccggatcctgcgggctatggggaaggcctaccaccct
ggctgcttcacctgcgtggtgtgtcaccgcggcctcgacggcatccccttcacagtggat
gctacgagccagatccactgcattgaggactttcacaggaagtttgccccaagatgctca
gtgtgcggtggggccataatgcctgagccaggtcaggaggagactgtgagaattgttgct
ctggatcgaagttttcacattggctgttacaagtgcgaggagtgtgggctgctgctctcc
tctgagggcgagtgtcagggctgctacccgctggatgggcacatcttgtgcaaggcctgc
agcgcctggcgcatccaggagctctcagccaccgtcaccactgactgctga

DBGET integrated database retrieval system