KEGG   Homo sapiens (human): 7222Help
Entry
7222              CDS       T01001                                 

Gene name
TRPC3, SCA41, TRP3
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 3
  KO
K04966  
transient receptor potential cation channel subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    7222 (TRPC3)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   7222 (TRPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q27
AA seq 848 aa AA seqDB search
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLE
ESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEA
ILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLL
MKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALE
LSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVH
RHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGL
PFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVT
DYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIF
IAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEG
LYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYS
YYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVV
VLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFI
MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMK
RLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKL
NPSMLRCE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggagggaagcccatccctgagacgcatgacagtgatgcgggagaagggccggcgccag
gctgtcaggggcccggccttcatgttcaatgaccgcggcaccagcctcaccgccgaggag
gagcgcttcctcgacgccgccgagtacggcaacatcccagtggtgcgcaagatgctggag
gagtccaagacgctgaacgtcaactgcgtggactacatgggccagaacgcgctgcagctg
gctgtgggcaacgagcacctggaggtgaccgagctgctgctcaagaaggagaacctggcg
cgcattggcgacgccctgctgctcgccatcagcaagggctacgtgcgcatcgtagaggcc
atcctcaaccaccctggcttcgcggccagcaagcgtctcactctgagcccctgtgagcag
gagctgcaggacgacgacttctacgcttacgacgaggacggcacgcgcttctcgccggac
atcacccccatcatcctggcggcgcactgccagaaatacgaagtggtgcacatgctgctg
atgaagggtgccaggatcgagcggccgcacgactatttctgcaagtgcggggactgcatg
gagaagcagaggcacgactccttcagccactcacgctcgaggatcaatgcctacaagggg
ctggccagcccggcttacctctcattgtccagcgaggacccggtgcttacggccctagag
ctcagcaacgagctggccaagctggccaacatagagaaggagttcaagaatgactatcgg
aagctctccatgcaatgcaaagactttgtagtgggtgtgctggatctctgccgagactca
gaagaggtagaagccattctgaatggagatctggaatcagcagagcctctggaggtacac
aggcacaaagcttcattaagtcgtgtcaaacttgccattaagtatgaagtcaaaaagttt
gtggctcatcccaactgccagcagcagctcttgacgatctggtatgagaacctctcaggc
ctaagggagcagaccatagctatcaagtgtctcgttgtgctggtcgtggccctgggcctt
ccattcctggccattggctactggatcgcaccttgcagcaggctggggaaaattctgcga
agcccttttatgaagtttgtagcacatgcagcttctttcatcatcttcctgggtctgctt
gtgttcaatgcctcagacaggttcgaaggcatcaccacgctgcccaatatcacagttact
gactatcccaaacagatcttcagggtgaaaaccacccagtttacatggactgaaatgcta
attatggtctgggttcttggaatgatgtggtctgaatgtaaagagctctggctggaagga
cctagggaatacattttgcagttgtggaatgtgcttgactttgggatgctgtccatcttc
attgctgctttcacagccagattcctagctttccttcaggcaacgaaggcacaacagtat
gtggacagttacgtccaagagagtgacctcagtgaagtgacactcccaccagagatacag
tatttcacttatgctagagataaatggctcccttctgaccctcagattatatctgaaggc
ctttatgccatagctgttgtgctcagcttctctcggattgcgtacatcctccctgcaaat
gagagctttggccccctgcagatctctcttggaaggactgtaaaggacatattcaagttc
atggtcctctttattatggtgttttttgcctttatgattggcatgttcatactttattct
tactaccttggggctaaagttaatgctgcttttaccactgtagaagaaagtttcaagact
ttattttggtcaatatttgggttgtctgaagtgacttccgttgtgctcaaatatgatcac
aaattcatagaaaatattggatacgttctttatggaatatacaatgtaactatggtggtc
gttttactcaacatgctaattgctatgattaatagctcatatcaagaaattgaggatgac
agtgatgtagaatggaagtttgctcgttcaaaactttggttatcctattttgatgatgga
aaaacattacctccacctttcagtctagttcctagtccaaaatcatttgtttatttcatc
atgcgaattgttaactttcccaaatgcagaaggagaaggcttcagaaggatatagaaatg
ggaatgggtaactcaaagtccaggttaaacctcttcactcagtctaactcaagagttttt
gaatcacacagttttaacagcattctcaatcagccaacacgttatcagcagataatgaaa
agacttataaagcggtatgttttgaaagcacaagtagacaaagaaaatgatgaagttaat
gaaggtgaattaaaagaaatcaagcaagatatctccagccttcgttatgaacttttggaa
gacaagagccaagcaactgaggaattagccattctaattcataaacttagtgagaaactg
aatcccagcatgctgagatgtgaatga

DBGET integrated database retrieval system