KEGG   Homo sapiens (human): 7224Help
Entry
7224              CDS       T01001                                 

Gene name
TRPC5, PPP1R159, TRP5
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 5
  KO
K04968  
transient receptor potential cation channel subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    7224 (TRPC5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7224 (TRPC5)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   7224 (TRPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq23
AA seq 973 aa AA seqDB search
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRR
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSFSTSSTELSQR
DDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP
SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
LSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHK
WGDGQEEQVTTRL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcccaactgtactacaaaaaggtcaactactcaccgtacagagaccgcatccccctg
caaattgtgagggctgagacagagctctctgcagaggagaaggccttcctcaatgctgtg
gagaagggggactatgccactgtgaagcaggcccttcaggaggctgagatctactataat
gttaacatcaactgcatggaccccttgggccggagtgccctgctcattgccattgagaac
gagaacctggagatcatggagctactgctgaaccacagcgtgtatgtgggtgatgcattg
ctctatgccatacgcaaggaagtggtgggcgctgtggagcttctgctcagctacaggcgg
cccagcggagagaagcaggtccccactctgatgatggacacgcagttctctgaattcaca
ccggacatcactcccatcatgctggctgcccacaccaacaactacgaaatcatcaaattg
cttgtccaaaaacgggtcactatcccacggccccaccagatccgctgcaactgtgtggag
tgtgtgtctagttcagaggtagacagcctgcgccactctcgctcccgactgaacatctat
aaggctctggcaagcccctcactcattgccttatcaagtgaggaccccatcctaactgcc
ttccgtctgggctgggagctcaaggagctcagcaaggtggagaatgagttcaaggccgag
tatgaggagctctctcagcagtgcaagctctttgccaaagacctgctggaccaagctcgg
agctccagggaactggagatcatcctcaaccatcgagatgaccacagtgaagagcttgac
cctcagaagtaccatgacctggccaagttgaaggtggcaatcaaataccaccagaaagag
tttgttgctcagcccaactgccaacagttgcttgccaccctgtggtatgatggcttccct
ggatggcggcggaaacactgggtagtcaagcttctaacctgcatgaccattgggttcctg
tttcccatgctgtctatagcctacctgatctcacccaggagcaaccttgggctgttcatc
aagaaaccctttatcaagtttatctgccacacagcatcctatttgaccttcctctttatg
cttctcctggcttctcagcacattgtcaggacagaccttcatgtacaggggcctccccca
actgtcgtggaatggatgatattgccttgggttctaggtttcatttggggtgagattaag
gaaatgtgggatggtggatttactgaatacatccatgactggtggaacctgatggatttt
gcaatgaactccctctacctggcaactatttccctgaagattgtggcctatgtcaagtat
aatggttctcgtccaagggaggaatgggaaatgtggcacccgactctgattgcggaagca
ctcttcgcaatatccaacattttaagttcgttgcgtctcatatccctgttcacagccaac
tcccacttaggacctctgcagatctctttgggacgcatgctgcttgatatcctcaaattc
ctctttatctactgcctggtactactagcttttgccaatggactgaaccagctttacttc
tattatgaaaccagagctatcgatgagcctaacaactgcaaggggatccgatgtgagaaa
cagaacaatgccttctccacgctctttgagactcttcagtcactcttctggtctgtattt
ggccttttaaatctatatgtcaccaatgtgaaagccagacacgaattcaccgagtttgta
ggagctaccatgtttggaacatacaatgtcatctccctggtagtgctgctgaacatgctg
attgctatgatgaacaactcctatcagcttattgccgatcatgctgatatcgagtggaag
tttgcaaggacgaagctctggatgagttactttgatgaaggtggcaccttgccacctcct
ttcaacatcatccccagccccaagtcatttctataccttggtaactggttcaacaacacc
ttctgccccaaaagagaccctgacggtagacggagaaggcgcaacttgagaagtttcaca
gaacgcaatgctgacagcctgatacaaaatcaacattatcaggaagttatcaggaattta
gtcaaaagatatgtggctgctatgataagaaattccaaaacacatgagggacttacagaa
gaaaattttaaggaattaaagcaagacatctccagctttcggtatgaagtgcttgacctc
ttgggaaatagaaaacatccaaggagcttttccactagcagcactgaactgtctcagaga
gacgataataatgatggcagtggtggggctcgggccaaatccaagagtgtctcttttaat
ttaggctgcaagaaaaagacttgccatgggccacctctcatcagaaccatgccaaggtcc
agtggtgcccaaggaaagtcaaaagctgagtcatcaagcaaacgctccttcatgggtcct
tctctcaagaaactgggtctcctattctccaaatttaatggtcatatgtctgaacccagt
tcagagccaatgtacacaatttctgatggaattgttcagcagcactgtatgtggcaggac
atcagatattctcagatggagaaagggaaagcagaggcctgttctcaaagtgaaattaac
ctcagtgaggtagaattaggtgaagtccagggcgctgctcagagcagtgaatgccctcta
gcctgttccagctctcttcactgtgcatccagcatctgctcctcaaattctaaactttta
gactcctcagaggatgtatttgaaacttggggagaggcttgtgacttgctcatgcacaaa
tggggtgatggacaggaagaacaagttacaactcgcctctaa

DBGET integrated database retrieval system