KEGG   Homo sapiens (human): 7226Help
Entry
7226              CDS       T01001                                 

Gene name
TRPM2, EREG1, KNP3, LTRPC2, LTrpC-2, NUDT9H, NUDT9L1, TRPC7
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 2 (EC:3.6.1.13)
  KO
K04977  
transient receptor potential cation channel subfamily M member 2 [EC:3.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    7226 (TRPM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     7226 (TRPM2)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   7226 (TRPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 1503 aa AA seqDB search
MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLS
SWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQ
EMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNF
NMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIG
VATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVA
DVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR
EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
PSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVL
VEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILK
ELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQL
ALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQD
VGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV
CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNE
RRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAF
PEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAA
PPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQ
KQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTARALHWIVRTLRA
SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE
KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQ
AGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLP
LSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWI
ETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
AHY
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atggagccctcagccctgaggaaagctggctcggagcaggaggagggctttgaggggctg
cccagaagggtcactgacctggggatggtctccaatctccggcgcagcaacagcagcctc
ttcaagagctggaggctacagtgccccttcggcaacaatgacaagcaagaaagcctcagt
tcgtggattcctgaaaacatcaagaagaaagaatgcgtgtattttgtggaaagttccaaa
ctgtctgatgctgggaaggtggtgtgtcagtgtggctacacgcatgagcagcacttggag
gaggctaccaagccccacaccttccagggcacacagtgggacccaaagaaacatgtccag
gagatgccaaccgatgcctttggcgacatcgtcttcacgggcctgagccagaaggtgaaa
aagtacgtccgagtctcccaggacacgccctccagcgtgatctaccacctcatgacccag
cactgggggctggacgtccccaatctcttgatctcggtgaccgggggggccaagaacttc
aacatgaagccgcggctgaagagcattttccgcagaggcctggtcaaggtggctcagacc
acaggggcctggatcatcacaggggggtcccacaccggcgtcatgaagcaggtaggcgag
gcggtgcgggacttcagcctgagcagcagctacaaggaaggcgagctcatcaccatcgga
gtcgccacctggggcactgtccaccgccgcgagggcctgatccatcccacgggcagcttc
cccgccgagtacatactggatgaggatggccaagggaacctgacctgcctagacagcaac
cactctcacttcatcctcgtggacgacgggacccacggccagtacggggtggagattcct
ctgaggaccaggctggagaagttcatatcggagcagaccaaggaaagaggaggtgtggcc
atcaagatccccatcgtgtgcgtggtgctggagggcggcccgggcacgttgcacaccatc
gacaacgccaccaccaacggcaccccctgtgtggttgtggagggctcgggccgcgtggcc
gacgtcattgcccaggtggccaacctgcctgtctcggacatcactatctccctgatccag
cagaaactgagcgtgttcttccaggagatgtttgagaccttcacggaaagcaggattgtc
gagtggaccaaaaagatccaagatatcgtccggaggcggcagctgctgactgtcttccgg
gaaggcaaggatggtcagcaggacgtggatgtggccatcttgcaggccttgctgaaagcc
tcacggagccaagaccactttggccacgagaactgggaccaccagctgaaactggcagtg
gcatggaatcgcgtggacattgcccgcagtgagatcttcatggatgagtggcagtggaag
ccttcagatctgcaccccacgatgacagctgcactcatctccaacaagcctgagtttgtg
aagctcttcctggagaacggggtgcagctgaaggagtttgtcacctgggacaccttgctc
tacctgtacgagaacctggacccctcctgcctgttccacagcaagctgcagaaggtgctg
gtggaggatcccgagcgcccggcttgcgcgcccgcggcgccccgcctgcagatgcaccac
gtggcccaggtgctgcgggagctgctgggggacttcacgcagccgctttatccccggccc
cggcacaacgaccggctgcggctcctgctgcccgttccccacgtcaagctcaacgtgcag
ggagtgagcctccggtccctctacaagcgttcctcaggccatgtgaccttcaccatggac
cccatccgtgaccttctcatttgggccattgtccagaaccgtcgggagctggcaggaatc
atctgggctcagagccaggactgcatcgcagcggccttggcctgcagcaagatcctgaag
gaactgtccaaggaggaggaggacacggacagctcggaggagatgctggcgctggcggag
gagtatgagcacagagccatcggggtcttcaccgagtgctaccggaaggacgaagagaga
gcccagaaactgctcacccgcgtgtccgaggcctgggggaagaccacctgcctgcagctc
gccctggaggccaaggacatgaagtttgtgtctcacgggggcatccaggccttcctgacc
aaggtgtggtggggccagctctccgtggacaatgggctgtggcgtgtgaccctgtgcatg
ctggccttcccgctgctcctcaccggcctcatctccttcagggagaagaggctgcaggat
gtgggcacccccgcggcccgcgcccgtgccttcttcaccgcacccgtggtggtcttccac
ctgaacatcctctcctacttcgccttcctctgcctgttcgcctacgtgctcatggtggac
ttccagcctgtgccctcctggtgcgagtgtgccatctacctctggctcttctccttggtg
tgcgaggagatgcggcagctcttctatgaccctgacgagtgcgggctgatgaagaaggca
gccttgtacttcagtgacttctggaataagctggacgtcggcgcaatcttgctcttcgtg
gcagggctgacctgcaggctcatcccggcgacgctgtaccccgggcgcgtcatcctctct
ctggacttcatcctgttctgcctccggctcatgcacatttttaccatcagtaagacgctg
gggcccaagatcatcattgtgaagcggatgatgaaggacgtcttcttcttcctcttcctg
ctggctgtgtgggtggtgtccttcggggtggccaagcaggccatcctcatccacaacgag
cgccgggtggactggctgttccgaggggccgtctaccactcctacctcaccatcttcggg
cagatcccgggctacatcgacggtgtgaacttcaacccggagcactgcagccccaatggc
accgacccctacaagcctaagtgccccgagagcgacgcgacgcagcagaggccggccttc
cctgagtggctgacggtcctcctactctgcctctacctgctcttcaccaacatcctgctg
ctcaacctcctcatcgccatgttcaactacaccttccagcaggtgcaggagcacacggac
cagatttggaagttccagcgccatgacctgatcgaggagtaccacggccgccccgccgcg
ccgccccccttcatcctcctcagccacctgcagctcttcatcaagagggtggtcctgaag
actccggccaagaggcacaagcagctcaagaacaagctggagaagaacgaggaggcggcc
ctgctatcctgggagatctacctgaaggagaactacctccagaaccgacagttccagcaa
aagcagcggcccgagcagaagatcgaggacatcagcaataaggttgacgccatggtggac
ctgctggacctggacccactgaagaggtcgggctccatggagcagaggttggcctccctg
gaggagcaggtggcccagacagcccgagccctgcactggatcgtgaggacgctgcgggcc
agcggcttcagctcggaggcggacgtccccactctggcctcccagaaggccgcggaggag
ccggatgctgagccgggaggcaggaagaagacggaggagccgggcgacagctaccacgtg
aatgcccggcacctcctctaccccaactgccctgtcacgcgcttccccgtgcccaacgag
aaggtgccctgggagacggagttcctgatctatgacccacccttttacacggcagagagg
aaggacgcggccgccatggaccccatgggagacaccctggagccactgtccacgatccag
tacaacgtggtggatggcctgagggaccgccggagcttccacgggccgtacacagtgcag
gccgggttgcccctgaaccccatgggccgcacaggactgcgtgggcgcgggagcctcagc
tgcttcggacccaaccacacgctgtaccccatggtcacgcggtggaggcggaacgaggat
ggagccatctgcaggaagagcataaagaagatgctggaagtgctggtggtgaagctccct
ctctccgagcactgggccctgcctgggggctcccgggagccaggggagatgctacctcgg
aagctgaagcggatcctccggcaggagcactggccgtcttttgaaaacttgctgaagtgc
ggcatggaggtgtacaaaggctacatggatgacccgaggaacacggacaatgcctggatc
gagacggtggccgtcagcgtccacttccaggaccagaatgacgtggagctgaacaggctg
aactctaacctgcacgcctgcgactcgggggcctccatccgatggcaggtggtggacagg
cgcatcccactctatgcgaaccacaagaccctcctccagaaggcagccgctgagttcggg
gctcactactga

DBGET integrated database retrieval system