KEGG   Homo sapiens (human): 7249Help
Entry
7249              CDS       T01001                                 

Gene name
TSC2, LAM, PPP1R160, TSC4
Definition
tuberous sclerosis 2
Orthology
K07207  
tuberous sclerosis 2
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Choline metabolism in cancer
Disease
H00896  
Lymphangioleiomyomatosis (LAM)
H00915  
Tuberous sclerosis complex (TSC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7249 (TSC2)
   04152 AMPK signaling pathway
    7249 (TSC2)
   04150 mTOR signaling pathway
    7249 (TSC2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    7249 (TSC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    7249 (TSC2)
   04919 Thyroid hormone signaling pathway
    7249 (TSC2)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    7249 (TSC2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7249 (TSC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 1807 aa AA seqDB search
MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSMECGLNNRIRM
IGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHAVLALLKAIVQGQGERLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDI
LLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKKTS
GPLSPPTGPPGPAPAGPAVRLGSVPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRYK
VLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALISYHNYL
DKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIIIKALPVLVVKLTHISATASMA
VPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
ALDVPASQFLGSATSPGPRTAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAST
AKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVLVEPPGLEDV
EAALGMDRRTDAYSRSSSVSSQEEKSLHAEELVGRGIPIERVVSSEGGRPSVDLSFQPSQ
PLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRGQ
PEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFV
FLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELA
ILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFH
IATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYEC
NLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKW
IARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSV
EDFTEFV
NT seq 5424 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccaacaagcaaagattcaggcttgaaggagaagtttaagattctgttggga
ctgggaacaccgaggccaaatcccaggtctgcagagggtaaacagacggagtttatcatc
accgcggaaatactgagagaactgagcatggaatgtggcctcaacaatcgcatccggatg
atagggcagatttgtgaagtcgcaaaaaccaagaaatttgaagagcacgcagtggaagca
ctctggaaggcggtcgcggatctgttgcagccggagcggccgctggaggcccggcacgcg
gtgctggctctgctgaaggccatcgtgcaggggcagggcgagcgtttgggggtcctcaga
gccctcttctttaaggtcatcaaggattacccttccaacgaagaccttcacgaaaggctg
gaggttttcaaggccctcacagacaatgggagacacatcacctacttggaggaagagctg
gctgactttgtcctgcagtggatggatgttggcttgtcctcggaattccttctggtgctg
gtgaacttggtcaaattcaatagctgttacctcgacgagtacatcgcaaggatggttcag
atgatctgtctgctgtgcgtccggaccgcgtcctctgtggacatagaggtctccctgcag
gtgctggacgccgtggtctgctacaactgcctgccggctgagagcctcccgctgttcatc
gttaccctctgtcgcaccatcaacgtcaaggagctctgcgagccttgctggaagctgatg
cggaacctccttggcacccacctgggccacagcgccatctacaacatgtgccacctcatg
gaggacagagcctacatggaggacgcgcccctgctgagaggagccgtgttttttgtgggc
atggctctctggggagcccaccggctctattctctcaggaactcgccgacatctgtgttg
ccatcattttaccaggccatggcatgtccgaacgaggtggtgtcctatgagatcgtcctg
tccatcaccaggctcatcaagaagtataggaaggagctccaggtggtggcgtgggacatt
ctgctgaacatcatcgaacggctccttcagcagctccagaccttggacagcccggagctc
aggaccatcgtccatgacctgttgaccacggtggaggagctgtgtgaccagaacgagttc
cacgggtctcaggagagatactttgaactggtggagagatgtgcggaccagaggcctgag
tcctccctcctgaacctgatctcctatagagcgcagtccatccacccggccaaggacggc
tggattcagaacctgcaggcgctgatggagagattcttcaggagcgagtcccgaggcgcc
gtgcgcatcaaggtgctggacgtgctgtcctttgtgctgctcatcaacaggcagttctat
gaggaggagctgattaactcagtggtcatctcgcagctctcccacatccccgaggataaa
gaccaccaggtccgaaagctggccacccagttgctggtggacctggcagagggctgccac
acacaccacttcaacagcctgctggacatcatcgagaaggtgatggcccgctccctctcc
ccacccccggagctggaagaaagggatgtggccgcatactcggcctccttggaggatgtg
aagacagccgtcctggggcttctggtcatccttcagaccaagctgtacaccctgcctgca
agccacgccacgcgtgtgtatgagatgctggtcagccacattcagctccactacaagcac
agctacaccctgccaatcgcgagcagcatccggctgcaggcctttgacttcctgttgctg
ctgcgggccgactcactgcaccgcctgggcctgcccaacaaggatggagtcgtgcggttc
agcccctactgcgtctgcgactacatggagccagagagaggctctgagaagaagaccagc
ggccccctttctcctcccacagggcctcctggcccggcgcctgcaggccccgccgtgcgg
ctggggtccgtgccctactccctgctcttccgcgtcctgctgcagtgcttgaagcaggag
tctgactggaaggtgctgaagctggttctgggcaggctgcctgagtccctgcgctataaa
gtgctcatctttacttccccttgcagtgtggaccagctgtgctctgctctctgctccatg
ctttcaggcccaaagacactggagcggctccgaggcgccccagaaggcttctccagaact
gacttgcacctggccgtggttccagtgctgacagcattaatctcttaccataactacctg
gacaaaaccaaacagcgcgagatggtctactgcctggagcagggcctcatccaccgctgt
gccagccagtgcgtcgtggccttgtccatctgcagcgtggagatgcctgacatcatcatc
aaggcgctgcctgttctggtggtgaagctcacgcacatctcagccacagccagcatggcc
gtcccactgctggagttcctgtccactctggccaggctgccgcacctctacaggaacttt
gccgcggagcagtatgccagtgtgttcgccatctccctgccgtacaccaacccctccaag
tttaatcagtacatcgtgtgtctggcccatcacgtcatagccatgtggttcatcaggtgc
cgcctgcccttccggaaggattttgtccctttcatcactaagggcctgcggtccaatgtc
ctcttgtcttttgatgacacccccgagaaggacagcttcagggcccggagtactagtctc
aacgagagacccaagagtctgaggatagccagaccccccaaacaaggcttgaataactct
ccacccgtgaaagaattcaaggagagctctgcagccgaggccttccggtgccgcagcatc
agtgtgtctgaacatgtggtccgcagcaggatacagacgtccctcaccagtgccagcttg
gggtctgcagatgagaactccgtggcccaggctgacgatagcctgaaaaacctccacctg
gagctcacggaaacctgtctggacatgatggctcgatacgtcttctccaacttcacggct
gtcccgaagaggtctcctgtgggcgagttcctcctagcgggtggcaggaccaaaacctgg
ctggttgggaacaagcttgtcactgtgacgacaagcgtgggaaccgggacccggtcgtta
ctaggcctggactcgggggagctgcagtccggcccggagtcgagctccagccccggggtg
catgtgagacagaccaaggaggcgccggccaagctggagtcccaggctgggcagcaggtg
tcccgtggggcccgggatcgggtccgttccatgtcggggggccatggtcttcgagttggc
gccctggacgtgccggcctcccagttcctgggcagtgccacttctccaggaccacggact
gcaccagccgcgaaacctgagaaggcctcagctggcacccgggttcctgtgcaggagaag
acgaacctggcggcctatgtgcccctgctgacccagggctgggcggagatcctggtccgg
aggcccacagggaacaccagctggctgatgagcctggagaacccgctcagccctttctcc
tcggacatcaacaacatgcccctgcaggagctgtctaacgccctcatggcggctgagcgc
ttcaaggagcaccgggacacagccctgtacaagtcactgtcggtgccggcagccagcacg
gccaaaccccctcctctgcctcgctccaacacagtggcctctttctcctccctgtaccag
tccagctgccaaggacagctgcacaggagcgtttcctgggcagactccgccgtggtcatg
gaggagggaagtccgggcgaggttcctgtgctggtggagcccccagggttggaggacgtt
gaggcagcgctaggcatggacaggcgcacggatgcctacagcaggtcgtcctcagtctcc
agccaggaggagaagtcgctccacgcggaggagctggttggcaggggcatccccatcgag
cgagtcgtctcctcggagggtggccggccctctgtggacctctccttccagccctcgcag
cccctgagcaagtccagctcctctcccgagctgcagactctgcaggacatcctcggggac
cctggggacaaggccgacgtgggccggctgagccctgaggttaaggcccggtcacagtca
gggaccctggacggggaaagtgctgcctggtcggcctcgggcgaagacagtcggggccag
cccgagggtcccttgccttccagctccccccgctcgcccagtggcctccggccccgaggt
tacaccatctccgactcggccccatcacgcaggggcaagagagtagagagggacgcctta
aagagcagagccacagcctccaatgcagagaaagtgccaggcatcaaccccagtttcgtg
ttcctgcagctctaccattcccccttctttggcgacgagtcaaacaagccaatcctgctg
cccaatgagtcacagtcctttgagcggtcggtgcagctcctcgaccagatcccatcatac
gacacccacaagatcgccgtcctgtatgttggagaaggccagagcaacagcgagctcgcc
atcctgtccaatgagcatggctcctacaggtacacggagttcctgacgggcctgggccgg
ctcatcgagctgaaggactgccagccggacaaggtgtacctgggaggcctggacgtgtgt
ggtgaggacggccagttcacctactgctggcacgatgacatcatgcaagccgtcttccac
atcgccaccctgatgcccaccaaggacgtggacaagcaccgctgcgacaagaagcgccac
ctgggcaacgactttgtgtccattgtctacaatgactccggtgaggacttcaagcttggc
accatcaagggccagttcaactttgtccacgtgatcgtcaccccgctggactacgagtgc
aacctggtgtccctgcagtgcaggaaagacatggagggccttgtggacaccagcgtggcc
aagatcgtgtctgaccgcaacctgcccttcgtggcccgccagatggccctgcacgcaaat
atggcctcacaggtgcatcatagccgctccaaccccaccgatatctacccctccaagtgg
attgcccggctccgccacatcaagcggctccgccagcggatctgcgaggaagccgcctac
tccaaccccagcctacctctggtgcaccctccgtcccatagcaaagcccctgcacagact
ccagccgagcccacacctggctatgaggtgggccagcggaagcgcctcatctcctcggtg
gaggacttcaccgagtttgtgtga

DBGET integrated database retrieval system