KEGG   Homo sapiens (human): 7252Help
Entry
7252              CDS       T01001                                 

Gene name
TSHB, TSH-B, TSH-BETA
Definition
thyroid stimulating hormone, beta
Orthology
K05251  
thyroid stimulating hormone, beta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Thyroid hormone synthesis
Autoimmune thyroid disease
Disease
H00250  
Congenital nongoitrous hypothyroidism (CHNG)
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p13
AA seq 138 aa AA seqDB search
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYLVGFSV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctctttctgatgtccatgctttttggccttacatgtgggcaagcgatgtct
ttttgtattccaactgagtatacaatgcacatcgaaaggagagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgcacatatagagacttcatctacagg
actgtagaaataccaggatgcccactccatgttgctccctatttttcctatcctgttgct
ttaagctgtaagtgtggcaagtgcaatactgactatagtgactgcatacatgaagccatc
aagacaaactactgtaccaaacctcagaagtcttatctggtaggattttctgtctaa

DBGET integrated database retrieval system