KEGG   Homo sapiens (human): 7252Help
Entry
7252              CDS       T01001                                 

Gene name
TSHB, TSH-B, TSH-BETA
Definition
thyroid stimulating hormone, beta
Orthology
K05251  
thyroid stimulating hormone, beta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Thyroid hormone synthesis
Autoimmune thyroid disease
Disease
H00250  
Congenital nongoitrous hypothyroidism (CHNG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7252 (TSHB)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    7252 (TSHB)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    7252 (TSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p13
AA seq 138 aa AA seqDB search
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYLVGFSV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctctttctgatgtccatgctttttggccttacatgtgggcaagcgatgtct
ttttgtattccaactgagtatacaatgcacatcgaaaggagagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgcacatatagagacttcatctacagg
actgtagaaataccaggatgcccactccatgttgctccctatttttcctatcctgttgct
ttaagctgtaagtgtggcaagtgcaatactgactatagtgactgcatacatgaagccatc
aagacaaactactgtaccaaacctcagaagtcttatctggtaggattttctgtctaa

DBGET integrated database retrieval system