KEGG   Homo sapiens (human): 7253Help
Entry
7253              CDS       T01001                                 

Gene name
TSHR, CHNG1, LGR3, hTSHR-I
Definition
(RefSeq) thyroid stimulating hormone receptor
  KO
K04249  
thyroid stimulating hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Thyroid hormone synthesis
Regulation of lipolysis in adipocytes
Autoimmune thyroid disease
Disease
H00250  
Congenital nongoitrous hypothyroidism (CHNG)
H01269  
Congenital hyperthyroidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    7253 (TSHR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7253 (TSHR)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    7253 (TSHR)
   04918 Thyroid hormone synthesis
    7253 (TSHR)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    7253 (TSHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Thyrotropin
    7253 (TSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P16473(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
14q31.1
AA seq 764 aa AA seqDB search
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPD
ALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTA
LPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
IMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQ
VQKVTHEMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggcggacttgctgcagctggtgctgctgctcgacctgcccagggacctgggc
ggaatggggtgttcgtctccaccctgcgagtgccatcaggaggaggacttcagagtcacc
tgcaaggatattcaacgcatccccagcttaccgcccagtacgcagactctgaagcttatt
gagactcacctgagaactattccaagtcatgcattttctaatctgcccaatatttccaga
atctacgtatctatagatgtgactctgcagcagctggaatcacactccttctacaatttg
agtaaagtgactcacatagaaattcggaataccaggaacttaacttacatagaccctgat
gccctcaaagagctccccctcctaaagttccttggcattttcaacactggacttaaaatg
ttccctgacctgaccaaagtttattccactgatatattctttatacttgaaattacagac
aacccttacatgacgtcaatccctgtgaatgcttttcagggactatgcaatgaaaccttg
acactgaagctgtacaacaatggctttacttcagtccaaggatatgctttcaatgggaca
aagctggatgctgtttacctaaacaagaataaatacctgacagttattgacaaagatgca
tttggaggagtatacagtggaccaagcttgctggacgtgtctcaaaccagtgtcactgcc
cttccatccaaaggcctggagcacctgaaggaactgatagcaagaaacacctggactctt
aagaaacttccactttccttgagtttccttcacctcacacgggctgacctttcttaccca
agccactgctgtgcttttaagaatcagaagaaaatcagaggaatccttgagtccttgatg
tgtaatgagagcagtatgcagagcttgcgccagagaaaatctgtgaatgccttgaatagc
cccctccaccaggaatatgaagagaatctgggtgacagcattgttgggtacaaggaaaag
tccaagttccaggatactcataacaacgctcattattacgtcttctttgaagaacaagag
gatgagatcattggttttggccaggagctcaaaaacccccaggaagagactctacaagct
tttgacagccattatgactacaccatatgtggggacagtgaagacatggtgtgtaccccc
aagtccgatgagttcaacccgtgtgaagacataatgggctacaagttcctgagaattgtg
gtgtggttcgttagtctgctggctctcctgggcaatgtctttgtcctgcttattctcctc
accagccactacaaactgaacgtcccccgctttctcatgtgcaacctggcctttgcggat
ttctgcatggggatgtacctgctcctcatcgcctctgtagacctctacactcactctgag
tactacaaccatgccatcgactggcagacaggccctgggtgcaacacggctggtttcttc
actgtctttgcaagcgagttatcggtgtatacgctgacggtcatcaccctggagcgctgg
tatgccatcaccttcgccatgcgcctggaccggaagatccgcctcaggcacgcatgtgcc
atcatggttgggggctgggtttgctgcttccttctcgccctgcttcctttggtgggaata
agtagctatgccaaagtcagtatctgcctgcccatggacaccgagacccctcttgctctg
gcatatattgtttttgttctgacgctcaacatagttgccttcgtcatcgtctgctgctgt
tatgtgaagatctacatcacagtccgaaatccgcagtacaacccaggggacaaagatacc
aaaattgccaagaggatggctgtgttgatcttcaccgacttcatatgcatggccccaatc
tcattctatgctctgtcagcaattctgaacaagcctctcatcactgttagcaactccaaa
atcttgctggtactcttctatccacttaactcctgtgccaatccattcctctatgctatt
ttcaccaaggccttccagagggatgtgttcatcctactcagcaagtttggcatctgtaaa
cgccaggctcaggcataccgggggcagagggttcctccaaagaacagcactgatattcag
gttcaaaaggttacccacgagatgaggcagggtctccacaacatggaagatgtctatgaa
ctgattgaaaactcccatctaaccccaaagaagcaaggccaaatctcagaagagtatatg
caaacggttttgtaa

DBGET integrated database retrieval system