KEGG   Homo sapiens (human): 7264Help
Entry
7264              CDS       T01001                                 

Gene name
TSTA3, FX, P35B, SDR4E1
Definition
tissue specific transplantation antigen P35B (EC:1.1.1.271)
Orthology
K02377  
GDP-L-fucose synthase [EC:1.1.1.271]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 321 aa AA seqDB search
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEK
VQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPD
KTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNF
NIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPI
ILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTP
FKQAVKETCAWFTDNYEQARK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaccccagggatccatgcggattctagtgacagggggctctgggctggtaggc
aaagccatccagaaggtggtagcagatggagctggacttcctggagaggactgggtgttt
gtctcctctaaagacgccgatctcacggatacagcacagacccgcgccctgtttgagaag
gtccaacccacacacgtcatccatcttgctgcaatggtggggggcctgttccggaatatc
aaatacaatttggacttctggaggaaaaacgtgcacatgaacgacaacgtcctgcactcg
gcctttgaggtgggcgcccgcaaggtggtgtcctgcctgtccacctgtatcttccctgac
aagacgacctacccgatagatgagaccatgatccacaatgggcctccccacaacagcaat
tttgggtactcgtatgccaagaggatgatcgacgtgcagaacagggcctacttccagcag
tacggctgcaccttcaccgctgtcatccccaccaacgtcttcgggccccacgacaacttc
aacatcgaggatggccacgtgctgcctggcctcatccacaaggtgcacctggccaagagc
agcggctcggccctgacggtgtggggtacagggaatccgcggaggcagttcatatactcg
ctggacctggcccagctctttatctgggtcctgcgggagtacaatgaagtggagcccatc
atcctctccgtgggcgaggaagatgaggtctccatcaaggaggcagccgaggcggtggtg
gaggccatggacttccatggggaagtcacctttgatacaaccaagtcggatgggcagttt
aagaagacagccagtaacagcaagctgaggacctacctgcccgacttccggttcacaccc
ttcaagcaggcggtgaaggagacctgtgcttggttcactgacaactacgagcaggcccgg
aagtga

DBGET integrated database retrieval system