KEGG   Homo sapiens (human): 7272Help
Entry
7272              CDS       T01001                                 

Gene name
TTK, CT96, ESK, MPH1, MPS1, MPS1L1, PYT
Definition
TTK protein kinase (EC:2.7.12.1)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7272 (TTK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     7272 (TTK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  TTK family
   7272 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q14.1
AA seq 856 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEK
HTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQL
STPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVFQ
VLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMV
MECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLK
LIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLG
CILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRIS
IPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGES
HNSSSSKTFEKKRGKK
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgagtttgttgctcaaactagagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctgcggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccggttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacatgccaccacaagatgcagaaataggttaccggaattcattgaga
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagattgtgatgtgaagacagatgattcagttgtaccttgttttatgaaaagacaa
acctctagatcagaatgccgagatttggttgtgcctggatctaaaccaagtggaaatgat
tcctgtgaattaagaaatttaaagtctgttcaaaatagtcatttcaaggaacctctggtg
tcagatgaaaagagttctgaacttattattactgattcaataaccctgaagaataaaacg
gaatcaagtcttctagctaaattagaagaaactaaagagtatcaagaaccagaggttcca
gagagtaaccagaaacagtggcaatctaagagaaagtcagagtgtattaaccagaatcct
gctgcatcttcaaatcactggcagattccggagttagcccgaaaagttaatacagagaaa
cataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccaccaatatcaaca
tctaaatggtttgacccaaaatctatttgtaagacaccaagcagcaataccttggatgat
tacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcagttg
tcaacaccttatggccaacctgcctgtttccagcagcaacagcatcaaatacttgccact
ccacttcaaaatttacaggttttagcatcttcttcagcaaatgaatgcatttcggttaaa
ggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtatttcag
gtgttaaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagcagat
aaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaacac
agtgataagatcatccgactttatgattatgaaatcacggaccagtacatctacatggta
atggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgatcca
tgggaacgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaacat
ggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgctaaag
ctaattgattttgggattgcaaaccaaatgcaaccagatacaacaagtgttgttaaagat
tctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcc
agagagaatgggaaatctaagtcaaagataagccccaaaagtgatgtttggtccttagga
tgtattttgtactatatgacttacgggaaaacaccatttcagcagataattaatcagatt
tctaaattacatgccataattgatcctaatcatgaaattgaatttcccgatattccagag
aaagatcttcaagatgtgttaaagtgttgtttaaaaagggacccaaaacagaggatatcc
attcctgagctcctggctcatccatatgttcaaattcaaactcatccagttaaccaaatg
gccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaattct
cctaactccattttgaaagctgctaaaactttatatgaacactatagtggtggtgaaagt
cataattcttcatcctccaagacttttgaaaaaaaaaggggaaaaaaatga

DBGET integrated database retrieval system