KEGG   Homo sapiens (human): 7273Help
Entry
7273              CDS       T01001                                 

Gene name
TTN, CMD1G, CMH9, CMPD4, EOMFC, HMERF, LGMD2J, MYLK5, TMD
Definition
titin (EC:2.7.11.1)
Orthology
K12567  
titin [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
H00594  
Distal muscular dystrophies
Class
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31
AA seq 34350 aa AA seqDB search
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV
VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS
EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK
IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA
VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP
GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT
DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA
TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK
EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV
TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE
AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA
APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK
LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP
KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY
RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP
KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY
VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG
RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE
KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST
VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF
RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK
RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR
VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY
RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE
SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI
DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR
VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT
KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG
RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI
EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE
CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT
IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH
DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE
TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF
RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR
MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY
KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ
PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN
AVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINET
LELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNG
VLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHK
DTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQ
LCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTD
TPCKAKSTPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHI
AKANELSSQLPLGAQELQSILEQDKLTPESTREFLCINGSIHFQPLKEPSPNLQLQIVQS
QKTFSKEGILMPEEPETQAVLSDTEKIFPSAMSIEQINSLTVEPLKTLLAEPEGNYPQSS
IEPPMHSYLTSVAEEVLSPKEKTVSDTNREQRVTLQKQEAQSALILSQSLAEGHVESLQS
PDVMISQVNYEPLVPSEHSCTEGGKILIESANPLENAGQDSAVRIEEGKSLRFPLALEEK
QVLLKEEHSDNVVMPPDQIIESKREPVAIKKVQEVQGRDLLSKESLLSGIPEEQRLNLKI
QICRALQAAVASEQPGLFSEWLRNIEKVEVEAVNITQEPRHIMCMYLVTSAKSVTEEVTI
IIEDVDPQMANLKMELRDALCAIIYEEIDILTAEGPRIQQGAKTSLQEEMDSFSGSQKVE
PITEPEVESKYLISTEEVSYFNVQSRVKYLDATPVTKGVASAVVSDEKQDESLKPSEEKE
ESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAKEVNW
YFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKR
AAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSL
EILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICT
VTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADI
CQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKIC
FEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGE
SARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAV
NDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRS
SKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDL
IALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGK
YTCLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKD
GRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAP
FFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEII
RVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGST
PLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL
FVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVES
TAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL
AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGS
SICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIR
MTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQG
DPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEV
QNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQ
EISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEK
PQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKAT
DSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRV
SWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKE
PPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLH
ITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAG
SPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYA
FLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFEN
NVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSS
IHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSN
VAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSG
PKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASK
IVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGD
FICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKD
KRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFV
SKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKA
EPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPEL
SVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV
SDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDN
VCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFT
SVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ
ASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCN
IVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVG
DSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKA
ENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGV
LLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFF
DIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKV
GKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPE
IKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALT
VKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDT
SLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAI
VEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMR
ECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHI
TFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAI
LGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTC
VAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRE
LVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRL
ADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIED
YAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISW
YKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARK
LPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATL
QILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKC
HVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKD
SCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFR
MSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKG
ADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKA
TNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIV
RESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPE
SIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDS
GVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISV
SWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVRE
PPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELE
LFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTG
TPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSA
QILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRN
NVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLP
VVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATN
PIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREI
RSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTK
RLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAG
MNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSE
PIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKV
TIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWR
QLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKI
EGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELL
KQSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDA
VFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGP
HIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTE
VEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATF
ECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG
EARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPE
EKKPPPKRIEVTKKAVKKDAKKVVAKPKEMTPREEIVKKPPPPTTLIPAKAPEIIDVSSK
AEEVKIMTITRKKEVQKEKEAVYEKKQAVHKEKRVFIESFEEPYDELEVEPYTEPFEQPY
YEEPDEDYEEIKVEAKKEVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEAYQEREVIQVQ
KEVYEESHERKVPAKVPEKKAPPPPKVIKKPVIEKIEKTSRRMEEEKVQVTKVPEVSKKI
VPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKEIVTEEK
IHVAISKRVEPPPKVPELPEKPAPEEVAPVPIPKKVEPPAPKVPEVPKKPVPEEKKPVPV
PKKEPAAPPKVPEVPKKPVPEEKIPVPVAKKKEAPPAKVPEVQKGVVTEEKITIVTQREE
SPPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKVPALPKKPVPEEKVAVPVPVAKKAPPP
RAEVSKKTVVEEKRFVAEEKLSFAVPQRVEVTRHEVSAEEEWSYSEEEEGVSISVYREEE
REEEEEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQEKKIVLKPKIPAKIE
EPPPAKVPEAPKKIVPEKKVPAPVPKKEKVPPPKVPEEPKKPVPEKKVPPKVIKMEEPLP
AKVTERHMQITQEEKVLVAVTKKEAPPKARVPEEPKRAVPEEKVLKLKPKREEEPPAKVT
EFRKRVVKEEKVSIEAPKREPQPIKEVTIMEEKERAYTLEEEAVSVQREEEYEEYEEYDY
KEFEEYEPTEEYDQYEEYEEREYERYEEHEEYITEPEKPIPVKPVPEEPVPTKPKAPPAK
VLKKAVPEEKVPVPIPKKLKPPPPKVPEEPKKVFEEKIRISITKREKEQVTEPAAKVPMK
PKRVVAEEKVPVPRKEVAPPVRVPEVPKELEPEEVAFEEEVVTHVEEYLVEEEEEYIHEE
EEFITEEEVVPVIPVKVPEVPRKPVPEEKKPVPVPKKKEAPPAKVPEVPKKPEEKVPVLI
PKKEKPPPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVPVPAPKKV
EAPPAKVPEVPKKLIPEEKKPTPVPKKVEAPPPKVPKKREPVPVPVALPQEEEVLFEEEI
VPEEEVLPEEEEVLPEEEEVLPEEEEVLPEEEEIPPEEEEVPPEEEYVPEEEEFVPEEEV
LPEVKPKVPVPAPVPEIKKKVTEKKVVIPKKEEAPPAKVPEVPKKVEEKRIILPKEEEVL
PVEVTEEPEEEPISEEEIPEEPPSIEEVEEVAPPRVPEVIKKAVPEAPTPVPKKVEAPPA
KVSKKIPEEKVPVPVQKKEAPPAKVPEVPKKVPEKKVLVPKKEAVPPAKGRTVLEEKVSV
AFRQEVVVKERLELEVVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRVEEEH
RVEKVHRVIEVFEAEEVEVFEKPKAPPKGPEISEKIIPPKKPPTKVVPRKEPPAKVPEVP
KKIVVEEKVRVPEEPRVPPTKVPEVLPPKEVVPEKKVPVPPAKKPEAPPPKVPEAPKEVV
PEKKVPVPPPKKPEVPPTKVPEVPKAAVPEKKVPEAIPPKPESPPPEVPEAPKEVVPEKK
VPAAPPKKPEVTPVKVPEAPKEVVPEKKVPVPPPKKPEVPPTKVPEVPKVAVPEKKVPEA
IPPKPESPPPEVFEEPEEVALEEPPAEVVEEPEPAAPPQVTVPPKKPVPEKKAPAVVAKK
PELPPVKVPEVPKEVVPEKKVPLVVPKKPEAPPAKVPEVPKEVVPEKKVAVPKKPEVPPA
KVPEVPKKPVLEEKPAVPVPERAESPPPEVYEEPEEIAPEEEIAPEEEKPVPVAEEEEPE
VPPPAVPEEPKKIIPEKKVPVIKKPEAPPPKEPEPEKVIEKPKLKPRPPPPPPAPPKEDV
KEKIFQLKAIPKKKVPEKPQVPEKVELTPLKVPGGEKKVRKLLPERKPEPKEEVVLKSVL
RKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEIKPA
IPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPI
KGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVG
SSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLR
LGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVE
KPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR
DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPED
IAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKG
ELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLK
DVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGV
YTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL
HTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKT
AVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC
DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTAS
PDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFE
KDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEA
EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS
VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKD
EVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGT
DKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCE
IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA
TFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFK
THANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIV
ADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARF
ECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTS
GMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTE
GRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVC
SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH
LTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLV
YTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTF
WCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSV
AELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKD
GSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLA
ELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK
LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTS
FRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEP
LTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTG
EPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKT
SIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPS
PPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKV
TGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIT
ILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRV
KTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT
WTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPEN
VKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEE
GKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPAT
VTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRAT
AVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKL
SSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLEPSD
ITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKY
RFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGA
KIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSD
PVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV
DTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVV
DVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTE
VQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGG
SPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSE
ISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRL
TMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITK
SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRV
KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG
YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK
AVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLV
RRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAP
CTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVV
TSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDAPDKPIVED
VTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYV
FRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEI
VGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPV
TVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVID
NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC
LLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKN
KFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEK
RRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEV
PPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEV
SRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAES
CYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRV
RAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGY
WLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPS
DPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKR
VNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFID
IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENS
SVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWK
MPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGI
GPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAW
DPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVTVKD
QTCPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKL
VVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQ
MTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMA
QNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWL
EMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPA
TARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDK
EVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDR
IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMVIKNCQRSHQGVY
SLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVI
EKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREP
ITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLS
RKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVG
EAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVV
ENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKE
VGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPD
APDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRV
PDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTW
QPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVN
AAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWK
KEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPP
RDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHL
NEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKP
DRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLP
DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKT
DEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINI
LDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCE
YVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGS
PITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSD
PIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRI
NKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVT
CRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVR
ADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEI
TNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPIL
AINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKG
SIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTV
KAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGK
YVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYIL
EKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKY
DKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPER
RMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSI
TLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEY
EFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGR
PAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNV
RVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVK
KTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKN
SATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRV
AARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWK
KGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG
PPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRV
GKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWD
RPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAG
SSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPG
DKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPP
RIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTL
ELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPL
EDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP
VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVN
WTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPA
FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTG
LMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRL
YVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCG
KKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSW
STVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVR
SVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKEYTF
RVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPS
VSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV
GKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKT
TFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVS
LTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAI
NLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKR
DLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEY
EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT
SSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTW
TPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYG
KGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREK
KSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP
GPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQF
VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLS
IRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPA
GKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS
YSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNI
MDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEY
TFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRP
KPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITI
QVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTV
IRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAVTKD
SMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRV
IAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIV
EKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCR
DDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIA
DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCV
LSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVN
KYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVER
RDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTV
FKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKA
TSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIR
ACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTV
ENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRES
TRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPG
KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQ
GEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIG
RPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETL
NVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSA
TVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSS
RDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEF
RVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGY
IVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAIT
ARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIK
STDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEK
CTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMA
VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVL
EKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD
PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGI
NKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN
IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTL
TLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKR
EATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP
PGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNL
TQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPI
SGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTA
SIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVV
SATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATA
ISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEY
EFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMIT
GYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGP
ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE
IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTS
EKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRI
MAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGY
IVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKA
CDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQT
GLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKG
IVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKY
ILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVID
KRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPP
SPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVT
GLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEI
PVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA
TENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWH
MVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFV
TSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGL
EYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSK
ITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSS
GAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAA
RMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTG
VTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYI
FRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEI
EGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVF
YRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCT
PPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADL
RKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDS
GRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNY
IVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVS
EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEA
TISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLK
IDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSA
GSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT
WHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTP
KVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDE
GLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGG
AKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSE
STGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEER
ARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEIN
GLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEY
IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSE
ISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSP
LIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTS
IQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMR
KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSRTSLTIENANRNDSG
KYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYH
IEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITE
KPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHV
VSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSN
LKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAAN
SSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETS
TAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPP
STPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTT
ISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAF
DGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISN
PSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKEL
QTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPI
EFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKG
NEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADG
GSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSE
PSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEW
TTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDL
DVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQ
VTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDG
GSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCET
TEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAG
ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQV
TVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGK
YTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYS
IEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQ
FRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISG
REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITL
KWNPPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNA
VGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWF
KDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPG
KVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTA
IKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWA
RPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAA
GVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMC
KADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLT
APELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTL
TVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPL
LDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEP
YEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWV
EAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGIT
NQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRG
DSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEI
TNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPII
AEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKV
PCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRS
TVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYE
FRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGG
KPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSV
MVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGE
CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGK
EHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQF
RVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDI
VGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIA
EIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAII
DTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDS
VTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLP
ENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEA
CKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLR
VLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKV
AKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISW
EPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG
IGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEV
RADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPP
GKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYT
LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGV
IRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKC
GKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKA
AWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPS
NPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTG
LVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEK
PECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGL
SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL
IQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYP
LKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQR
KTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGS
WITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVS
SVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIS
VTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEE
LRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVT
DDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSG
KPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKT
VELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQ
ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETRE
VSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVK
KEISILNIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVH
QVCEALQFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEY
YAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKE
ISIEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKD
LNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIEN
YDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSY
AELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTI
TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE
DSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQ
PLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQ
EFKSKEEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKG
EFRLEIEEKKEERKLRMPYDVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKIRDQYEMP
GKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEIVRPARRRTPS
PDYDFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPP
HFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPTKAEASTSYAELRERHAQAAYRQPKQR
QRIMAEREDEELLRPVTTTQHLSEYKSELDFMSKEEKSRKKSRRQREVTEITEIEEEYEI
SKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSPTPER
TRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHA
PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI
LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA
YAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTR
KIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK
YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRV
KSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIA
KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEI
SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPV
IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHK
TDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEIS
QKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASE
EVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQT
LTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLF
TCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRG
QCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSAS
SMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEA
LPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDV
QKQDGGLYTLSLGNEFGSDSATVNIHIRSI
NT seq 103053 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggttttccagttcctgaggtgagctggttt
agggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctaaactgacgatccccgccgtgactaaagccaacagtggacgatattccctg
aaagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgaaagctgag
acagcaccacccaacttcgttcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgacctctacagc
ttactgattgcagaagcataccctgaggactcagggacctattcagtaaatgccaccaat
agcgttggaagagctacttcgactgctgaattactggttcaaggtgaagaagaagtacct
gctaaaaagacaaagacaattgtttcgactgctcagatctcagaatcaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccgctgggcaacagctgccacataaaacacctcccaggattcctccgaag
ccaaagtcaagatccccaacaccaccgtctattgctgccaaagcacagctggctcggcag
cagtccccatcgcccataagacactccccttccccggtcagacacgtgcgggcaccgacc
ccatctccggtcaggtccgtgtctccagcagcaagaatctccacatcccccatcaggtct
gttaggtctccattgctcatgcgtaagactcaggcatccaccgtggccacaggtcctgaa
gtgcctcccccttggaagcaagagggctacgtggcctcctcatctgaggctgagatgaga
gagacaacgctgacaacctctactcagatcaggacagaagagagatgggaagggagatac
ggtgtccaggagcaagtgaccatcagtggtgctgcgggtgctgccgccagtgtgtcggcc
agtgctagctacgcagcagaggctgttgccactggtgctaaagaggtgaaacaagatgct
gacaaaagtgcagctgttgcgactgttgttgctgccgttgatatggccagagtgagagaa
ccagtgatcagcgctgtagagcagactgctcagaggacaaccacgactgctgtgcacatc
caacctgctcaagaacaggtaagaaaggaagcggagaagactgctgtaactaaggtagta
gtggccgccgataaagccaaggaacaagaattaaaatcaagaaccaaagaagtaattacc
acaaagcaagagcagatgcacgtaactcatgagcagataagaaaagaaactgaaaaaaca
tttgtaccaaaggtagtaatttccgcagctaaagccaaagaacaagaaactagaatttct
gaagaaattactaagaaacagaaacaagtaactcaagaagcaataagacaggaaactgag
ataactgctgcatccatggtggtagttgccactgcaaagtccacaaaactagaaacagtc
ccgggagctcaagaagaaactaccacacaacaagatcaaatgcacctaagttatgaaaag
ataatgaaggaaactaggaaaacagttgtacctaaagtcatagttgccacacccaaagtc
aaagaacaagatttagtatcaagaggtagagaaggcattactaccaaaagagaacaagtg
caaataactcaggagaagatgagaaaggaagccgagaaaactgccttgtctacaatagca
gttgctactgctaaagccaaagaacaagaaacaatactgagaactagagaaactatggct
actagacaagaacaaatccaagttacccatggaaaggtggacgttggaaaaaaggctgaa
gctgtagcaacagttgttgctgcagtagaccaggcccgagtcagagagcccagagagcct
gggcatcttgaagaatcctatgctcagcagaccactttggagtacggatataaggaacgc
atttccgccgcaaaggtagctgagcctccccaacgtccagcctcagaaccccacgttgtc
cctaaagcagtcaagcctagagtaatccaggctccttctgagactcatatcaaaactact
gatcaaaagggaatgcacatatcatcacagatcaagaaaactacagatctaacaacggaa
agattagtccatgtggataaacgcccccgcacagctagccctcactttactgtttcaaaa
atttctgttcctaagacagaacatggatatgaggcatcaatagccggtagtgctattgcc
acattacaaaaagagttgtcagccacatcttctgctcagaagatcaccaaatcggtgaag
gctcctactgtgaagcccagtgagactagagtaagggcagagcccacacccttgccacag
ttccccttcgctgacacaccagatacttacaagagtgaagctggcgttgaggtgaaaaag
gaagtaggggtgagcatcactggcaccaccgtccgtgaagagcgctttgaagtactgcac
ggacgcgaagccaaggtaacagaaacagcaagagtaccagcacctgttgaaattcctgtt
actccaccaactttggtctcgggcttaaaaaatgtgactgtcatagaaggtgaatctgtc
accttggagtgccacatctctggatacccatccccgacagtgacatggtacagggaagac
taccaaatcgaaagttccattgacttccagataaccttccagagtggaattgctcgtctt
atgattcgcgaagcatttgcggaagacagcgggcgatttacttgcagtgctgtaaatgag
gctggaaccgtcagcacatcctgctatctggctgtgcaggtgtcagaagaatttgaaaag
gaaaccacagccgtgactgagaaatttactacagaagagaaacgctttgttgagtcaaga
gatgtggttatgactgatactagcctcacagaggaacaagcagggcctggagaacctgcc
gcgccttactttattacaaaaccagtggtccagaaactggtggaaggtgggagcgtggtg
tttggatgccaagttggcggcaacccaaagccccatgtatactggaaaaaatctggtgtt
cctctaaccactggatacagatacaaagtgagttacaacaaacaaaccggtgaatgcaag
ctggtgatttctatgacttttgctgatgatgctggagaatacactattgttgttcgcaat
aagcatggagaaacttctgcatctgcttccttgcttgaagaagctgattatgagttactg
atgaagtcccagcaagaaatgctttatcagacacaagtgactgcatttgttcaagaacct
aaagttggagaaacagcacctggatttgtatactctgagtatgaaaaagagtatgaaaaa
gaacaagccttaattaggaagaaaatggccaaagatactgtagtggtcagaacttatgta
gaagatcaggaattccatatttcttcctttgaagagagacttattaaagaaattgaatat
agaataataaagactacattagaagaacttcttgaagaagatggagaagaaaagatggca
gttgacatttctgaatctgaagctgttgaatcaggatttgattcaagaatcaagaattat
agaattcttgaggggatgggtgtcacttttcattgcaagatgtctggatatccattacca
aagattgcttggtacaaagatggcaagcgcatcaaacatggagaaagataccaaatggac
tttctacaagatggcagagctagtctgcgtatacctgttgttcttccagaagatgaagga
atctacactgcatttgccagcaatattaaaggaaatgcaatttgctcagggaaattgtat
gtggagcctgctgcaccacttggagctccgacttacattcccacactagagccagtgagc
agaatcagatctctctctccacgttcagtgagcaggtctcctatacgcatgtctcctgca
cggatgtcacctgcaaggatgtctcctgcacggatgtcccctgcaagaatgtcccctgga
cgtaggctggaggagacagatgagtcacaacttgagagactatataaaccagtctttgtg
ttaaaacctgtttctttcaaatgtttagaagggcaaactgccagatttgacttaaaggtt
gttggtagacctatgccagagacgttctggtttcatgatggccagcaaattgtcaatgac
tatacccataaagtagtcattaaagaagatggtactcaatcactaattattgtccctgcc
acacccagtgattctggggaatggactgtggttgcccaaaacagggcaggcagatcttca
atttcagtgattttaactgtggaagctgtggaacatcaggtaaaaccgatgtttgtagaa
aaactgaaaaatgtcaatataaaggaaggttcccgacttgaaatgaaagtcagagctacg
ggtaaccccaaccctgacattgtatggttgaaaaacagtgacatcattgtgcctcataaa
tatcccaaaatcagaattgaaggaaccaagggagaagctgcccttaaaatcgattccact
gtcagccaagattctgcctggtatactgcgactgctattaataaagctggcagagacact
acaagatgcaaagtaaatgttgaagttgagtttgcagagcctgagccagagagaaagtta
atcatcccacgggggacatatagagcaaaggagattgcagccccagaactggagcccctc
catttgcgatatggccaagagcaatgggaagaaggtgatctctatgacaaagagaaacaa
cagaaaccatttttcaagaaaaaactcacttccttaagacttaagcgctttgggcctgcc
cactttgaatgcaggctaacacccattggtgacccaacgatggtggtggagtggctccat
gatggaaagccacttgaagcagccaacaggctccgtatgatcaatgaatttgggtactgc
agccttgattatggcgttgcatattctagagacagtggtatcattacttgcagagccact
aacaaatatggaacagatcacacatctgctacccttattgttaaagatgagaaaagtctt
gtggaagaatcccaattgcctgaggggaggaaaggcttacagagaattgaagaattagag
agaatggctcatgaaggtgcacttacaggtgtaacaacagatcagaaagaaaagcaaaag
ccagacattgtcttgtacccagagccagttagagtacttgaaggggagactgcaaggttc
cgctgcagggtaacaggctaccctcagcccaaagtcaactggtacctcaatggacagctc
atccgcaaaagcaaaaggttcagagttcgctatgatggtatccattacctggacatcgtg
gactgcaaatcatatgacacaggtgaagtgaaggtcaccgcggaaaatcctgaaggtgtg
atagagcataaagtgaagcttgagattcaacagagggaagattttaggtctgtccttagg
agagctcctgaaccaaggcctgagtttcacgtacatgaaccaggaaagcttcagtttgaa
gtacaaaaagtggatagacctgttgacaccactgaaaccaaagaagttgtgaagttgaaa
agggctgaaagaattacccatgaaaaagtgcctgaagagtcggaagagctgcgcagtaaa
ttcaagcgcagaacagaagagggctattatgaagccattaccgctgtggagctcaagtct
cgaaagaaggatgaatcctatgaggaactcctcaggaagacaaaagatgaacttctccac
tggaccaaagagttaactgaagaggaaaagaaagctcttgccgaagaaggcaaaatcacg
attccaacttttaaacctgacaagattgaactaagtcctagtatggaggctccaaaaatc
ttcgaaagaatccagagccaaacagtgggccaaggatctgatgcacacttccgggtcaga
gtcgtggggaaaccagaccccgaatgtgaatggtacaaaaatggtgtcaaaattgaacgg
tctgaccggatctactggtactggcccgaagacaatgtttgtgaattggtcataagagat
gtgactgctgaggactctgccagcatcatggtaaaagccatcaacatagctggagaaacc
tccagtcacgcattcttacttgtccaagccaagcaattgatcactttcacacaggaatta
caagatgttgttgctaaggaaaaagacactatggcaacctttgaatgtgaaacttcagaa
ccatttgtcaaagtgaaatggtataaagatggtatggaggttcatgagggagataaatac
aggatgcactctgacagaaaggttcacttcctctccatactgaccattgatacgtctgat
gctgaagattacagctgtgtacttgtggaagatgaaaatgtcaaaacgactgctaaactt
attgttgaaggtgcagttgttgagtttgtgaaagaacttcaggacatagaagttccagaa
tcatattcaggagaattagagtgcattgtatccccagaaaatatagaaggaaaatggtat
cataatgatgtggagcttaaatccaatggcaaatatacaattacatctcgtcgtggacgt
cagaacctcacggtcaaggatgtaaccaaggaggaccagggagaatacagctttgtcatc
gacgggaaaaagacaacctgtaaattaaagatgaaaccccgccccattgctatcctacaa
ggacttagtgaccaaaaagtctgtgagggtgacattgttcagcttgaagttaaagtctcc
ttggaaagtgtggaaggcgtctggatgaaagacggccaagaagtgcagcccagtgacagg
gttcacattgtgatagacaaacaatctcatatgctgctcattgaagacatgactaaggaa
gatgctggaaattactctttcaccattccagcccttggcctctccaccagtgggcgtgtc
tctgtctatagtgtggacgtgataacacctctaaaagatgttaatgtgattgaaggcacc
aaggctgtgcttgaatgtaaggtgtcagtccctgatgtgacttctgttaagtggtactta
aatgatgaacaaatcaagcctgatgaccgtgtacaggccattgtgaaaggtactaaacag
cgactagtcattaaccgaactcatgcttcagacgaaggaccttacaagctgatagttggc
agagttgaaaccaactgtaatctctctgtagaaaaaattaaaattatcagaggtcttcgt
gaccttacctgtacagaaactcaaaatgtggtgtttgaggttgagctgtcccactctgga
attgatgtcctgtggaattttaaggacaaggaaatcaagcccagttctaaatataaaatt
gaagcacatggaaaaatatataaattgacagttctaaatatgatgaaagatgatgaagga
aaatacacattttacgcgggagaaaatatgacatctggaaaacttactgtggcaggtggg
gccatctccaagccactcacagatcagaccgtagctgaatcccaggaagctgtgtttgaa
tgtgaagttgccaacccagattccaaaggcgaatggttgagggatggcaaacacctacca
ctgactaacaacatcagaagtgagtctgatggccacaaaaggagacttatcattgctgcc
accaaattagatgacattggagaatatacctacaaggtggccacctccaaaacatctgcc
aaactcaaagttgaagctgtcaaaattaagaagactctgaagaacctcacagtgacagaa
acacaggatgctgttttcactgtcgagcttacacaccctaatgtcaaaggtgtccagtgg
atcaaaaatggagttgtgctggaatccaatgaaaagtatgctatctctgtcaaaggaaca
atttactctctgaggattaaaaactgtgccatcgtggatgagtctgtttatggcttcagg
cttggaaggcttggagccagtgccagactgcacgtggagactgtcaagatcattaaaaag
ccaaaggatgtgacagccttggaaaatgccactgttgcctttgaagttagtgtttcccat
gacactgttccagtaaaatggttccataagagtgtggaaattaagccaagtgacaaacac
agactggtctcagaaaggaaagtccacaagctgatgctgcagaacatctccccctcagat
gctggggaatacacagctgtggtcgggcaattggaatgcaaagcaaaactgtttgtggag
acattacatattacaaaaaccatgaaaaatatcgaggtgcctgagaccaaaactgcctct
tttgagtgtgaggtgtcccacttcaatgtcccttccatgtggctgaagaatggtgtggaa
attgagatgagtgaaaagttcaagatagttgtgcagggaaaactccatcagctgatcatc
atgaacaccagcacagaggactcggcagaatacacatttgtctgtggcaatgaccaagtc
agtgccaccctgacagtcaccccaatcatgattacttccatgctgaaagacatcaacgct
gaagaaaaagacactattacttttgaggtgacagtgaactatgaaggcatctcttacaaa
tggttaaagaatggtgtggaaatcaaatcaactgacaagtgccagatgagaaccaaaaag
ctcacacactcactgaacatcaggaatgttcactttggggatgctgctgactacaccttt
gtggctggaaaagcaacatcaacagccacactttatgtggaagctcgtcatatagaattt
aggaaacacattaaggacattaaggtactggagaagaagcgagccatgtttgaatgtgaa
gtttctgaacctgacatcactgtacagtggatgaaagatgaccaggaactgcagatcaca
gacagaataaagattcagaaggagaaatatgtccaccgccttctgatcccatccacccgg
atgtctgatgctgggaagtacacagtggtggcaggaggcaacgtgtcaactgcaaaactc
tttgtagaaggcagagatgttcgcatccgaagtattaaaaaggaggttcaggtcattgag
aaacagcgtgctgttgttgaatttgaggtcaatgaagacgatgttgatgcccactggtat
aaagatggcattgaaatcaatttccaagttcaagaacgacacaaatatgtagtggaaaga
agaatccaccgaatgtttatctctgagaccagacagagcgatgcaggagaatacaccttt
gtggcaggaaggaacaggagttctgtcactctctatgtcaatgctcctgaaccgccccaa
gttctgcaggagctccagcctgtcactgtgcagtctggcaagcctgcccgcttctgtgcc
gtgatatccggaagaccacagcccaaaatttcctggtacaaggaagagcagctgctttcc
actggcttcaagtgcaaatttcttcatgatgggcaagaatacacgcttttgctaattgaa
gccttcccagaggatgcggcagtctatacctgtgaagccaagaatgactatggtgttgcc
acaacatcagcttcactctcagtggaagttccagaagttgtgtctcctgatcaggaaatg
cctgtttatccacctgccatcatcaccccgcttcaggacactgtcacttctgaagggcag
ccagcccgttttcaatgccgggtttctggaacagatctaaaagtgtcgtggtacagcaaa
gacaagaaaatcaagccatctcggttctttagaatgactcaatttgaagacacttatcaa
ctggaaattgccgaagcttatccagaagatgaaggaacttacacgtttgttgctagtaat
gctgtaggccaagtatcaagcacagccaacctgagtctggaagctcctgaatcaattttg
catgagaggattgaacaagagattgagatggaaatgaaagagttttctagttcttttctg
tctgccgaggaagaaggacttcatagcgccgaacttcaattatctaaaataaatgaaaca
cttgaacttttgtctgaatctccagtttacccaactaaatttgattccgaaaaggaaggc
actggcccaattttcatcaaagaagtgtcaaatgctgatataagcatgggggatgtggct
acactgtctgtaactgtcattggcatccccaaacctaaaattcagtggttctttaatgga
gtgctattaaccccttctgctgactacaaatttgtttttgacggtgatgatcatagcctg
atcattctgttcaccaaattggaggatgagggagagtatacatgtatggccagtaatgac
tatggaaagacaatatgtagtgcctatctaaaaattaattccaaaggagagggtcacaaa
gacactgaaacagaatcagcagtggcaaaatctctggaaaagctgggaggtccttgtcct
cctcacttccttaaggagttaaaaccaattcgctgtgctcaagggcttcctgccatcttt
gagtacacagtggttggagagcctgcccctactgttacatggttcaaagaaaacaagcag
ctttgcaccagtgtttattacactatcattcataaccctaatggctctggaactttcatt
gtcaatgaccctcagagggaagacagtggcctctatatctgtaaagcagagaatatgttg
ggtgagtccacctgtgcagcagagctgcttgtgcttctggaagacacagacatgactgat
accccctgcaaagcaaagtccacaccagaggctcctgaggattttccacagacaccctta
aagggtcccgcagttgaagcacttgactcagagcaggaaattgcaacgtttgtaaaagac
accattttgaaagctgctttaattacagaagaaaaccagcaactatcttatgagcatatt
gctaaagccaatgaattgagcagtcagcttcctttgggagctcaggaattgcaatccatt
ttggagcaagacaagctcactcctgaaagcaccagggaatttctttgcatcaatggcagt
attcactttcagcctctcaaggaaccatctcccaacctacagctgcagattgtacagtcc
cagaaaaccttctccaaagaaggtattctaatgcctgaagagcctgagacacaggcagtt
ctatcagataccgagaaaatcttcccaagtgccatgtccatagaacaaattaattcatta
acagttgagcctctgaaaactttattagctgaacctgaagggaattatccacagtcttca
atagaacctccaatgcattcttatctaacctctgtggctgaggaagtactttcaccaaaa
gaaaagacagtatctgacaccaacagagagcaaagagtgactcttcaaaagcaagaggca
caaagtgcgctcatcttgagtcagagcttagctgagggacacgtggagagtctccagagt
cctgatgtcatgatctctcaggtaaactatgagcccctagtcccttcagaacactcatgc
acagaaggaggtaaaattttgatagaaagtgcaaatccactggaaaatgcagggcaagat
tctgcggtcagaattgaggaaggcaagtccttaagatttccactagcacttgaagaaaag
caggtactgctcaaagaagagcattctgacaacgtggtgatgcccccagaccaaatcatt
gagtctaaaagagagcccgtggcaataaagaaagtgcaggaggtacagggaagggacctt
ctttctaaggaaagcttgctttctggtattccagaagagcagagattaaacctgaaaatt
caaatctgccgggctttgcaagcagccgtggccagcgagcagccaggtcttttctctgag
tggctaagaaatattgaaaaggtggaggtcgaggctgtaaacatcacccaagagcccaga
cacatcatgtgcatgtaccttgttacttcggcaaagtctgtaacagaagaagtaaccatc
attattgaagatgttgatcctcaaatggctaacctgaaaatggaacttagggatgctttg
tgtgctattatatatgaggaaatagacatcctaacagctgagggtcctagaattcagcaa
ggagccaaaacaagtttgcaagaagaaatggattctttttcaggttcacagaaggttgaa
cccattactgaaccagaagttgaatctaaatatctgatctcaactgaagaggtcagttat
tttaacgtgcaaagtagggttaaatatttggatgccacacctgtcactaaaggggttgct
tcagctgttgtctctgacgaaaaacaagatgagagtctgaaaccatcagaggaaaaagag
gagtcttcctctgaaagtggtactgaggaggttgctacagtaaagatacaggaagctgag
ggtggcttaatcaaagaggatggccccatgatacatacacctttagtggacactgtttct
gaggaaggtgatattgtacacctcacaacatccataacaaatgctaaagaggtgaattgg
tattttgagaataaactggtgccttcagatgaaaagttcaagtgtttacaagatcaaaat
acatatacgctagtcatcgacaaagtaaataccgaagaccatcaaggagagtatgtctgt
gaggccttgaatgacagcggaaaaacagcaacttcagccaaactcactgtagtaaaaaga
gctgccccagtgatcaagaggaaaatcgaacccctggaagtagcactgggccacctagcc
aaattcacctgtgagatccaaagtgctcccaatgtccggttccagtggtttaaagctggc
cgagaaatttatgagagtgacaagtgttctattcgatcttcaaagtatatctccagcctt
gaaatcctgagaacccaggtggttgactgcggcgagtatacatgcaaagcttccaatgag
tatggcagtgtcagctgtacagccacactaactgtgacagaggcatatccaccaaccttt
ctctccagacctaagtcccttacaacttttgtgggtaaggcagccaagttcatctgcaca
gtgacagggactcctgtgatagaaaccatttggcagaaagatggtgctgcactctcacct
tcacctaactggaggatttccgacgcagaaaacaaacacattttagaactctcaaacctt
accattcaagatagaggagtttattcttgtaaggcttccaacaagtttggagcagacatc
tgccaagcagagttgatcatcattgataagccacatttcattaaagaattagagcctgtg
cagtccgctatcaataagaaggtccaccttgagtgccaagtagatgaagacagaaaagtc
acagttacgtggagcaaagatgggcaaaaactccccccagggaaagattataagatctgt
tttgaagataaaatagcaacacttgagattcctttggccaaactgaaagattcaggaacc
tatgtctgtacagcttcaaatgaggctggaagcagctcctgctcagccacagtcactgtc
agagagccaccatccttcgtgaagaaggtggatccctcttatttaatgctcccaggtgaa
tcagcacgcctccattgcaagctgaaaggctcacctgtgatccaggttacttggtttaaa
aataacaaagaactcagtgaaagtaacacagtccgaatgtattttgtcaattctgaggct
atacttgatattacggatgtaaaagttgaagacagtgggagttactcatgtgaagcagtg
aatgacgtcggcagtgatagctgcagtactgaaatagttatcaaagaacctccttctttc
atcaaaactcttgagcctgcagacatagtgagaggaacaaatgctctacttcagtgtgaa
gtctcaggcactggaccatttgaaattagctggttcaaagacaagaaacaaattcgaagt
agtaaaaaatacagattgttttctcagaagtctcttgtgtgtctggagatcttttcgttt
aatagtgcagatgttggtgaatatgaatgtgttgttgctaatgaagtcggcaagtgtggc
tgcatggcaacccacttactcaaagaacctccaacctttgtaaagaaagtagatgatttg
attgcactaggaggacaaaccgttaccctgcaagctgctgtgagagggtcagagcccatt
tctgtcacatggatgaaaggtcaagaggtcatcagagaagacggaaaaatcaaaatgagc
ttttccaatggtgttgcagtcttgataatccctgatgttcagattagttttggaggcaaa
tacacgtgcctggctgaaaatgaagctggaagccaaacatctgttggggaattaatagtt
aaagaacctgccaaaatcattgagcgagcagaactgatccaggtgacagcaggagatccc
gccacactggagtacacagtggcaggcacgccagaactgaagcccaaatggtacaaagat
gggagacccttggtcgccagtaaaaaataccgaataagttttaaaaacaatgttgcccag
ctcaaattttattcagctgagctgcacgacagtggccaatacacatttgagatttccaat
gaagtgggcagcagctcctgtgagactacattcactgtattagatcgagacattgctcca
ttttttaccaaacccttgcgcaacgtggatagtgttgttaatggtacctgcagactggac
tgcaaaattgcaggctccctccccatgagggtgtcctggtttaaggatggcaaagaaata
gctgcttctgacagatacaggatagcatttgtggaaggcacagcctctttggagatcatc
agagtagacatgaatgatgcagggaatttcacttgtcgagccacaaattccgtgggaagc
aaagacagcagtggagccctgattgtgcaagaaccacccagttttgtaactaaacccggc
tcaaaggatgttctgcctggctcagcagtctgcctgaagagcactttccaaggatctact
cctctcacaatcagatggtttaagggcaacaaagagctggtttctggtggaagctgctat
attaccaaagaagctttagagagttccctggaactctatttagtaaaaacctctgattcg
ggcacgtacacatgtaaagtcagcaatgtcgctggaggggtggaatgcagtgcaaacttg
tttgtaaaagaacctgccacatttgttgaaaagttagagccatcacagctgttaaagaag
ggagatgccacccagctagcctgcaaagtaactggtacccctccaattaaaataacatgg
tttgcaaatgatagagaaattaaggagagcagcaaacacagaatgtcttttgtggagtct
actgcagttctaagactgacagatgttggcatcgaagacagtggtgaatatatgtgtgag
gcccaaaatgaggctggcagtgaccactgcagtagcattgtaatagtcaaagagtcacct
tattttaccaaggaatttaagccaattgaagtcttaaaggagtacgatgtcatgttgctg
gctgaggtggcaggcactcctccctttgagatcacttggttcaaagataacacaatcctg
cgaagtggtagaaagtataagactttcattcaggatcatctggttagcctgcagatcctc
aagtttgtagctgcagatgctggcgaataccagtgtcgggtgaccaatgaggtgggcagc
agcatctgcagtgccagggtgactttaagagaacccccatccttcataaagaagatcgag
agtaccagctccctccggggaggcacagctgccttccaggccactctgaagggctccttg
ccaattacggtgacttggctaaaagacagcgatgaaatcactgaagacgataatataaga
atgacctttgagaacaatgtggccagtttgtacctcagtggcattgaagtcaagcatgat
gggaaatatgtctgtcaggccaaaaatgatgcaggaatacaaagatgttctgcattactc
tcagtaaaagaacctgcaacaatcaccgaggaagctgtgtctatagatgtcacccaagga
gacccagccactttgcaggttaaattttcagggactaaggagattacagccaaatggttt
aaagatggccaagaactgaccctgggctcaaaatataaaatcagtgtcactgatacagtc
tcaatactgaagattatttctacagaaaagaaagatagtggagaatatactttcgaggtc
caaaatgatgttgggaggagcagctgcaaggctagaattaatgtattagatcttatcata
cctccttcattcaccaaaaagctgaagaaaatggacagcattaaaggttctttcattgat
ttagaatgtatagtggctgggtcacatcccataagcatccagtggttcaaagatgaccaa
gaaatatcagctagtgaaaagtacaaattctcttttcatgacaatactgccttcttggaa
atcagccagctggaaggtacagacagtgggacatacacttgttctgccacaaataaggca
gggcacaaccaatgcagtgggcatctgacagtcaaagaacccccttactttgtggaaaag
ccacagtcacaagatgtcaatcccaacacaagggtacagttaaaggctcttgtgggtggc
actgcacccatgacaataaagtggtttaaagataacaaagagttacactcaggagcagcc
cgctcagtttggaaggatgacacctctaccagtctagagctctttgcagccaaagctacc
gattctggaacctacatttgccaactaagcaatgatgttggcacagcaaccagcaaagcc
actctctttgtaaaagaacctcctcaattcattaagaagcccagtccagtcttagtgctg
aggaatggacagtcaacaacatttgaatgccaaataacaggcactcctaaaatccgagtg
tcttggtatctagacgggaatgaaataacagccattcagaaacatggcatttccttcatt
gatggtttagccactttccagatttctggtgccagggtagaaaatagtgggacttatgtg
tgtgaagctcgaaatgacgcaggcacggcgagctgcagcattgaactcaaagtgaaagaa
ccccccacctttatcagagagctgaagcctgtggaggtagtaaaatatagtgacgtggag
ctggagtgtgaagttacgggaacacctccgtttgaagtcacttggctgaagaataacagg
gaaattcgaagcagcaaaaaatacacattgaccgacagagtgtctgtgtttaacctccat
ataaccaagtgtgacccttcagacactggggaataccagtgcattgtatccaatgaaggc
ggcagctgctcatgcagtactagagttgccctgaaagaaccaccatcattcattaagaag
atagaaaataccactactgttttgaaaagttctgccacctttcagagtaccgtggcaggt
tctcctcctatttctataacctggctaaaggatgatcagattcttgatgaagatgataat
gtctatatttcatttgtggacagtgtggccacacttcaaatcagaagtgtggataatgga
cacagtgggagatatacctgtcaagccaagaatgagtcaggagttgagaggtgttatgct
ttccttttagtacaagaaccagctcaaatcgtagagaaagctaaatcagttgatgttacg
gagaaagatcccatgaccttggaatgtgttgtggctggaacaccagaactcaaagtgaaa
tggcttaaagacgggaaacaaatagttcccagtagatacttttcaatgagttttgaaaat
aacgtggccagttttagaattcagtcagtaatgaagcaggacagcggtcagtacactttc
aaggtggaaaatgacttcggaagcagtagctgtgatgcctacttaagagtgctagatcaa
aatattcctccatcattcaccaaaaaattaaccaaaatggataaagttctgggctcttct
attcatatggagtgcaaggtgtctggttcacttcccattagtgctcagtggtttaaggat
ggaaaagaaatatctacaagtgcaaaatacagacttgtgtgccatgagagatctgtgtct
ctggaagttaataatctggaattagaagatactgcaaattacacatgcaaagtgtcaaat
gtagcaggagatgatgcatgcagtggcatcttaactgtgaaagaaccaccaagcttccta
gtgaaacctgggcgacagcaagccatacctgattctacagtggaatttaaggcaatacta
aaaggaacaccaccatttaaaataaaatggtttaaggatgatgtggaacttgtctcaggt
cctaaatgtttcattggcttggaagggtcgactagcttcttaaatctctactcagtggat
gcttctaagactggacagtatacttgccatgttaccaatgatgttggtagcgactcttgt
actacgatgttgcttgtgacagaaccaccaaagtttgtaaagaaattagaagcctccaaa
attgtgaaagcaggtgactcttcacgacttgaatgcaagatagctggatccccagaaatc
agagttgtgtggttccgaaatgaacatgaacttccagccagtgataagtacagaatgact
ttcattgactcagtggccgtcatacagatgaacaatctcagtactgaggacagtggagat
ttcatttgtgaggctcagaatcccgctggcagcacaagctgcagtaccaaggttatagta
aaagagccacctgtttttagcagcttccctcctatagtagaaacccttaaaaatgctgaa
gtcagtcttgaatgtgaactttcgggaacaccaccgtttgaggtggtatggtacaaagac
aagcggcaactcagaagcagcaagaaatacaagattgcatccaaaaacttccacacaagt
attcacattctcaatgtggacacttcagacatcggtgaataccactgcaaagcacagaat
gaagtgggaagtgatacttgtgtttgtactgtaaaattgaaagaaccaccaagatttgtc
tccaaactgaacagcctcactgttgtagccggagagcctgctgaattacaagcatccata
gaaggcgcccagcctatttttgtccagtggcttaaagagaaggaagaagtgattagagaa
agtgaaaacatcaggattacatttgtggaaaatgttgcaactctacagtttgcaaaagca
gagccagctaatgctggaaagtatatctgccaaatcaagaatgatggtggaatgagggag
aacatggccacactgatggtcttagagcccgcagtcattgttgagaaggcaggaccgatg
acggtgactgtaggagaaacgtgcactctggagtgtaaggtggctggcactccggaactc
tctgttgaatggtacaaggatggaaagctgttgaccagcagccaaaaacacaaatttagc
ttctacaacaaaatctcttccttaaggattctctcagttgaaaggcaagatgcaggcaca
tacactttccaggttcaaaataatgttgggaaaagcagctgcacagctgtggttgatgtt
tcagaccgagcagttcctccctctttcacacgaagactgaaaaatactggtggggtgtta
ggtgcttcttgcatcttggaatgcaaagtagctggatcatcacctatttcagttgcctgg
tttcatgagaaaaccaagattgtcagtggagcaaagtaccaaaccacattttcagataat
gtctgcacattgcagttgaattctctggattcctcagatatgggcaattacacatgcgtg
gctgctaatgtcgctgggtctgatgaatgtcgtgcagtgctaactgtacaagaaccaccc
tcttttgtgaaagaacctgaacctttggaagtactaccaggcaaaaatgtaaccttcaca
agcgttattagaggaacccctccattcaaagtcaactggttcagaggtgccagagaacta
gtgaaaggagaccggtgcaacatctattttgaagacactgtggcagaactggaattattt
aatattgacatatctcagagtggggaatacacctgtgtggtttctaacaacgctggccaa
gcatcttgcactacccgtctctttgtgaaagaaccagctgcatttttgaagagattaagt
gatcattctgtagaaccagggaagtccataattctggagagcacctacactggaacactt
ccaatttctgtcacttggaaaaaggatggttttaacataactacctctgaaaaatgtaac
atagtcacaacagagaaaacttgtatcctggaaattctgaatagcacaaaaagagatgca
gggcagtattcctgcgagattgaaaatgaggcaggaagggatgtttgtggagctctggta
tctacattagaaccgccttattttgttacggaactggaacctctggaggcagcagttgga
gattcggtttctttacaatgccaagttgctgggacaccagaaattacagtgtcttggtac
aaaggagataccaaattacggccaactcctgaatacaggacctactttacaaacaatgtg
gccacacttgtttttaataaagtgaacatcaatgacagtggagagtacacatgcaaagca
gaaaatagtataggaactgcttcttctaagactgtgttcagaattcaagagcgccaactc
ccaccttcttttgcaagacaattaaaggacattgaacaaactgtggggttacctgttaca
ctcacttgtcgattaaatggctctgcacccatccaagtgtgctggtatagagatggagta
cttttaagagacgatgaaaatctacagacttcatttgtagataatgtggcaactttaaaa
attttgcaaactgacttgagtcactctggccagtactcttgctcagcttccaacccactt
ggaacagcatcttctagtgctagactcacagcaagagaacccaagaaatctcccttcttt
gacatcaagcctgtatctatagatgttattgctggagaaagtgctgattttgagtgtcat
gttactggtgctcaaccgatgcgaatcacttggtcaaaagataacaaggagatccgtcct
ggaggaaactatacaatcacatgtgtgggaaacactcctcatttgagaattcttaaagta
ggcaaaggagactctggtcaatatacttgccaagcaaccaatgatgttggcaaagacatg
tgctcagctcagctcagtgtaaaagaacctccaaagtttgttaagaaattagaagcttca
aaagttgcaaagcagggagaatccattcaactggaatgtaaaataagtggctccccagaa
atcaaagtttcatggttccgaaatgacagcgaacttcatgaaagttggaaatacaacatg
tcattcattaattctgtggcattgcttacgatcaatgaagctagtgctgaagacagcggg
gactacatttgtgaggctcataatggtgttggtgacgccagctgcagcacagcgttgaca
gtgaaagcacctcctgttttcacccagaagccttctccagtaggagctcttaaaggttct
gatgtgattctccaatgtgaaatttcgggaactcccccatttgaagtagtatgggttaaa
gatcgaaagcaggttagaaacagcaagaaatttaaaatcacttcaaaacattttgataca
agtcttcatatccttaatcttgaagcctccgatgtcggggaatatcactgcaaagctact
aatgaggtgggaagtgacacgtgttcttgctctgtcaagttcaaagaacctccacgattc
gtgaaaaagctaagtgacacctcaacccttattggggatgctgttgagttacgggccata
gtggagggcttccagccaatttctgttgtctggctgaaagatagaggtgaagtcatcaga
gagagtgaaaataccaggatttcattcattgataacattgcaaccctccagctggggagt
ccagaagcatctaattctggaaaatatatatgccaaatcaaaaacgatgctggaatgaga
gaatgctctgcagtcttgactgtactagaaccagcaagaatcatagagaagcccgaaccc
atgactgtcactactggaaatccttttgcattagagtgtgtagtgactggaacaccagaa
ctctcagccaagtggttcaaagatggaagagaattgtctgcagacagcaaacatcacatt
acattcatcaataaagtggcttcccttaaaatcccctgtgccgaaatgagtgacaaagga
ttatatagctttgaagtgaaaaacagtgttggcaaaagtaactgcactgtatccgtccat
gtttctgatcggattgtgcctccttccttcatccgcaagctgaaagacgtgaatgccatc
ctgggggcctcagttgttttggagtgccgagtctctggctcagccccgatttcagttggc
tggtttcaggatggaaatgagattgttagtgggcccaaatgtcagtccagcttttcggaa
aacgtctgtactttgaatctgagcttgttggagccctccgacacaggcatatacacgtgt
gtggctgccaatgtagctggttccgatgagtgctcagcagtcctgactgtgcaagaacca
ccatcttttgaacaaacccctgattctgtggaagttttgcctggaatgagcctcacattc
accagtgtcatcagaggcacccctcctttcaaggtcaagtggtttaaaggcagcagggaa
ctggtgcctggggagtcatgcaacatctctctggaagattttgtcacagaactggagttg
tttgaggtgcagccattagaaagtggagactattcttgcctcgttacaaatgatgctggc
agtgcttcctgtaccacacatctttttgtgaaagaaccagccacctttgtgaaaagattg
gctgatttcagtgttgagacaggaagccccatagttctcgaggccacatacactggcaca
cctccaatctcagtgagctggataaaggacgagtatcttatttcacaatctgagagatgc
agtattactatgacagaaaaatctaccatactggaaattcttgagagcacaatagaggat
tatgcacagtacagctgcctgatagaaaatgaggctggtcaagatatctgtgaagctctg
gtgtctgtcttagaaccaccgtactttattgaacctctggaacatgtggaagcagtcatt
ggagaacctgcaactttacagtgtaaagtggatggaactccagaaattagaatttcttgg
tataaagaacacacaaagctacgatcagctcctgcatataaaatgcaattcaaaaataac
gttgcttccttagtaatcaacaaagtggatcacagtgatgtgggagagtattcatgcaag
gcagacaacagtgtgggggcagtcgcttcttcagctgtgcttgttatcaaagcgcgcaaa
cttccacctttctttgcaagaaaactgaaagacgttcatgagactctaggcttcccagtt
gcatttgaatgccgcatcaatggctcagaacctcttcaagtgtcttggtacaaggatggg
gttcttttgaaagatgatgctaatttgcagacatcttttgttcataatgtagcaactctt
cagattttacaaactgaccagagccacatagggcagtataattgctctgcttctaatcct
cttgggactgcttcatccagtgccaagctcattctctcagagcatgaagtgcctcctttc
tttgatctaaagcctgtatcagtagatcttgctcttggagaaagtggtacttttaaatgt
catgtaactgggactgcaccaatcaaaatcacttgggccaaagataaccgagagattcgc
cctggaggcaactacaagatgactttggtagaaaatactgccactctgacagttctcaaa
gtaggcaaaggcgatgccgggcagtacacctgctatgcaagcaacatcgctggaaaagac
tcttgttctgctcagctgggtgtacaagaaccacccaggttcattaagaagctagaacct
tcaagaattgtgaaacaggatgaattcacaaggtatgaatgcaaaatcggtgggtctcca
gaaatcaaagttttatggtataaggacgagactgaaattcaagagagcagtaaattcaga
atgtcattcgttgactcggtggctgtgctggaaatgcacaatctcagtgttgaagacagt
ggagactacacctgtgaggcccacaatgcagcaggcagtgccagcagcagcacatcctta
aaagttaaagaaccacccattttccgcaaaaagcctcatcctatagagacactgaaagga
gctgatgttcaccttgaatgtgagcttcagggcactcccccatttcacgtttcttggtat
aaagacaagagagaacttaggagcggcaagaagtacaagataatgtctgagaacttccta
accagtatccacatcctgaatgtcgatgctgcagacattggggaatatcagtgtaaagcc
acaaatgatgtgggaagcgacacttgcgttggttccatcgctctcaaagcaccaccaaga
tttgtgaagaagctcagtgacatatctactgtcgttggtaaagaagttcagctgcagact
accattgaaggcgctgaacccatttcagtggtgtggttcaaagataagggagaaatcgtt
agagaaagtgacaacatatggatttcttattcagaaaacattgcaaccttacagttttca
agagtggaaccagccaatgctggaaaatacacttgtcagatcaaaaacgatgctgggatg
caagagtgcttcgccacgctatccgttctcgagcctgcaacaattgtagaaaagccagaa
tccataaaagttaccacgggagacacctgtaccttggagtgtacagtagctggcacccct
gaactcagtactaagtggtttaaggatggaaaagagctaacaagtgacaacaaatacaaa
ataagcttcttcaacaaagtatccggccttaagatcatcaatgtagcaccgagtgacagt
ggggtatacagttttgaggtgcagaaccctgttggcaaagacagctgcacagcttcattg
caggtttcagaccgaaccgttcctccttcattcacaagaaaattgaaagagacaaatggt
ctatccggctcctcagttgtaatggagtgtaaagtctatgggtcacctccaatctctgtc
tcctggttccatgaaggaaatgagatcagtagtggaaggaaataccagaccaccctgaca
gataatacttgtgctttaactgtgaacatgctggaagaatcagacagtggtgactacaca
tgtatagctactaatatggctggttctgatgaatgtagtgctcctttgactgtgagagaa
ccaccatcttttgttcagaaacctgatcccatggatgttttaactgggaccaatgtaact
ttcacaagtatcgtaaaaggaacacctcctttcagtgttagctggttcaaaggtagcagt
gaactagtaccaggtgacagatgcaacgtgtctttggaggattcagttgctgaactggag
ttgttcgatgtagatacatcacaaagtggagaatatacttgcatagttagcaatgaagct
ggcaaggcttcttgtacaacacatctctacataaaagccccagccaaatttgtgaagagg
ctgaatgattacagcatagagaaaggaaaacccctgatcctagagggtacattcactgga
actcctcccatttcggttacctggaagaaaaatggcataaatgtaactccttctcagagg
tgtaatataactacgactgaaaaatcggcaatcctggaaattccaagtagcacagtagag
gatgcaggacaatacaactgctacattgaaaatgcctctggaaaagattcctgttcagca
caaatactcatactagaaccaccgtattttgtcaagcagttggagccggttaaggtgtct
gttggagattctgcctctctacaatgccagcttgctggaacccctgaaattggggtatcc
tggtataaaggagatacaaaattgagacccactacgacttacaaaatgcattttaggaat
aatgttgctacactggttttcaaccaggttgatattaatgatagtggagaatatatctgc
aaagctgaaaacagcgtgggagaagtttctgcatcaactttccttaccgttcaagagcaa
aaacttccaccatcattttctcgacaattgagagatgttcaagaaacagttggactgcca
gttgtttttgattgtgccataagtggatcagaacctatctccgtgtcttggtataaagac
ggcaagccattgaaagacagcccaaatgtacaaacatcatttttagacaatacagccaca
ctcaatatttttaaaactgaccggagccttgcaggccagtattcctgcacagctacaaac
cctataggctctgcttcttccagtgccaggctcattctcacagaggggaagaacccaccc
ttctttgacatccgtcttgcccctgtggatgctgtggtgggagaaagtgctgactttgag
tgccacgtcacgggcacacaaccgataaaggtcagctgggccaaagacagcagagaaata
cgaagtggcggaaagtaccagattagttatctggaaaacagcgcccacctgacagtcctc
aaagtagacaaaggagattctggacaatatacctgctatgctgtgaatgaagtgggaaaa
gactcttgcacagctcagctgaatataaaagagcggctcatcccaccaagtttcactaaa
agactctcagagacagtagaagaaacagaagggaattctttcaaacttgagggacgtgtg
gctggttcccaacctataactgttgcctggtacaaaaataatatagagatacaaccaact
tctaactgtgaaataacattcaagaacaacacgttagtgctgcaagtcaggaaagcaggc
atgaacgacgctggtttgtacacatgcaaagtgtccaatgatgcaggctctgctctgtgc
acgtcttcaatcgtcatcaaagaacctaagaagccacctgtatttgatcagcaccttact
ccagtaacagtgagtgaaggagaatacgtgcagctcagctgccatgtccagggatctgag
ccaattaggatccagtggttgaaggctggcagggaaataaagccttcagacagatgcagc
ttcagctttgctagtgggacagctgtactggaactcagagatgtggctaaagcagattcg
ggagattatgtgtgtaaagcttcaaatgtggctggaagtgacactaccaaatcaaaagtg
accattaaagacaaaccagctgtggccccagcaaccaagaaagctgcggtagatggaaga
ctcttttttgtgtcagaacctcagagtatcagagtcgtagaaaaaaccactgcgaccttc
attgcaaaagttggaggtgacccaatcccaaatgttaaatggacaaaagggaagtggaga
cagctgaaccaaggaggtcgtgttttcatccaccaaaaaggcgatgaagcaaaactggag
attagggacaccacaaaaactgattctgggttataccgatgcgtggcatttaacgaacat
ggtgaaattgaaagtaatgttaacttacaggtggatgaaaggaagaaacaagagaaaatt
gaaggcgatcttagagcaatgctgaaaaagactccaatcttaaagaaaggagctggagaa
gaagaggaaattgatatcatggaacttctcaaaaatgttgatcctaaagaatatgaaaaa
tatgcccgcatgtatggaatcactgacttccgaggtcttcttcaagcatttgaactgctc
aagcaaagccaagaagaagagacacatagactggaaattgaggaaatagagaggtcagag
agggacgaaaaggaatttgaggaacttgtatcatttattcagcaaagactgtcacagaca
gagcctgtcactctgatcaaggacattgaaaatcagacagttttgaaagataatgatgct
gtctttgaaattgacattaaaattaattatccagaaatcaagctttcgtggtacaaagga
actgaaaaactggaacccagtgataaatttgaaataagcattgatggtgaccgacataca
ctcagagtcaaaaactgtcaacttaaagaccagggcaattatcgattggtttgtggtcca
cacatcgctagcgctaaactaactgtaattgagcctgcatgggaacggcatcttcaggat
gtgactctgaaagaaggccagacttgcaccatgacatgccaattttctgtaccaaatgta
aaatctgaatggttcagaaatggcagaatccttaaaccccaaggtagacataaaacagaa
gtggaacacaaagtccataaattgaccattgcagatgttcgagcagaagaccagggtcag
tacacctgcaaatatgaagaccttgaaacttcagcagaactcagaatcgaagctgaacca
attcagtttacaaagcgcatacagaacatcgtggtgagtgagcatcagtctgccaccttt
gagtgtgaagtgtcctttgatgatgccattgtaacatggtacaaaggaccaacagaactg
acagagagccagaaatacaacttcaggaatgatggccgctgccattatatgaccatccac
aatgtgaccccagacgatgaaggtgtctactcggtcatcgctcggctggagccaagaggt
gaagcaagaagcacggcagagctgtacctaacgacgaaagaaatcaaacttgagctgaag
cctcctgatattcctgactccagagttccaatcccaaccatgcctatcagagcagtgcca
ccagaagaaatccctcctgtggttgctcctcctatcccccttttgctaccaacacccgaa
gaaaagaaaccaccaccaaaacgtattgaagttaccaaaaaggctgtgaagaaagatgcc
aaaaaagttgttgcaaagcccaaagagatgacaccacgtgaagagattgtcaagaagcct
ccacctcctactaccttaattccagcaaaagctcctgaaatcattgatgtatcctctaaa
gctgaagaagtaaaaataatgactataaccagaaagaaagaggttcagaaagaaaaagaa
gctgtgtatgagaaaaagcaagcagtccacaaggagaagagagtcttcattgaatctttc
gaagaaccttatgacgaactggaggtagaaccatacacagagccatttgaacaaccttat
tatgaagaaccagatgaagactatgaagagattaaggtagaagctaaaaaagaagttcac
gaggaatgggaagaagattttgaagaagggcaagaatactatgaaagggaagaaggctat
gacgaaggggaggaagagtgggaagaggcttaccaagaaagggaagtaattcaagttcaa
aaggaggtctatgaagaatcacatgagagaaaagttccagccaaagtacctgaaaagaaa
gcaccaccacctcctaaagttataaagaagccagtaattgaaaaaattgaaaagacttct
cgaagaatggaggaagaaaaagttcaagtcaccaaagtacctgaagtttcaaagaagatt
gttccacaaaaaccttcccggactccagtacaggaagaagttattgaagtgaaagtacca
gctgtgcatacaaagaagatggttatttcagaagaaaagatgttctttgcttctcacaca
gaggaggaggtgtcagtcacagtccccgaggtacaaaaggaaattgttactgaagagaaa
attcacgttgccatttccaaaagggttgaaccaccacctaaagtccctgagctacctgag
aaaccagctccagaagaagtggcccctgttcctatccctaaaaaagtggagcccccagca
ccaaaagttcctgaggttcccaagaaacccgtgccagaggagaaaaagccagttcctgtg
cctaagaaggaacctgctgctcccccaaaagtcccagaggtgccaaagaaacctgtccct
gaagaaaagattcccgttcctgttgcaaagaaaaaggaagctcccccagctaaagttcct
gaagtacagaagggagttgtgacagaagaaaaaataaccattgtaactcaaagagaggaa
tctccaccaccagcagtgccagaaataccaaagaagaaagttcctgaagaaaggaaacct
gttcctcggaaggaggaagaagttccaccaccaccaaaagtgccagctctgcctaagaaa
cccgtcccagaggagaaagttgcagtgccagttcctgtcgctaagaaagctcctcctccc
cgagctgaagtctctaagaaaactgttgtagaagaaaagagatttgttgctgaagaaaaa
ctatccttcgcagttcctcaaagagtggaagtcacgcggcacgaagtatctgcagaggag
gaatggagttactcagaagaggaggaaggtgtgtccatttcagtttatagagaagaagaa
agagaggaggaggaagaagcagaggttacagaatatgaagtgatggaagagcctgaggaa
tatgttgtggaagaaaagctgcacattatttctaagagagtggaagctgagccagctgaa
gtgacagagaggcaggagaagaaaattgtactgaaaccaaaaattcctgctaaaatagag
gagcctccaccggctaaagttcctgaagcacctaagaaaattgtgccagaaaagaaagtt
cctgctccagttcctaaaaaggaaaaggtgcccccacctaaagtgccagaagagccaaag
aaaccagttccagaaaaaaaggttcctccaaaagtcattaagatggaagaacctctccca
gccaaagtgactgagaggcacatgcaaattacccaggaagaaaaagttcttgttgctgta
actaaaaaagaggcgcctccaaaagcaagagtgccagaggaaccgaagagagctgtccca
gaagaaaaagttctgaaactcaaacctaaaagagaggaggaaccaccagctaaagtgact
gaattcagaaaaagagtggttaaagaagaaaaagtatcaattgaagctccaaaaagagaa
cctcaacccatcaaagaagtaactataatggaagagaaagaaagggcttataccctagaa
gaagaagctgtttcagtacaacgggaagaagaatatgaggaatatgaagaatatgattat
aaagaatttgaggagtatgaaccaacagaagaatatgaccaatatgaagaatacgaggag
cgggagtatgaacgatatgaagagcatgaagaatacatcacagaaccagagaagcctatc
cctgtaaagcctgtcccagaagaaccagttcccacaaaaccaaaggccccaccggctaaa
gtgctgaagaaagctgtccctgaagaaaaagtaccagtgcccattcctaagaaactcaaa
cctccaccacccaaagtgcctgaagaaccaaagaaagtttttgaggaaaaaatacgtatt
tcaattaccaaacgtgaaaaagagcaggtgactgaacccgctgctaaagtgcccatgaag
cccaagagggttgtcgcagaagaaaaagtacctgtccctagaaaagaagtagcaccacct
gttagagtgccagaagtgcctaaagaacttgaaccagaagaggttgcctttgaagaggaa
gttgtaacccatgtagaagaatatcttgtagaagaagaagaagagtacattcatgaagaa
gaggagttcataactgaggaagaagtggtgccagtgataccagtcaaagtgcctgaggta
cccaggaaacctgttccagaagagaagaaacctgttcctgttcccaagaagaaggaagct
ccaccggcaaaagtgcctgaggttcctaagaagccagaggagaaagttcctgtgcttatt
cctaaaaaggagaagcctccgccagcaaaagttcctgaagtgcccaagaaacctgtgcca
gaggagaaagtaccagtaccagttcctaaaaaggtggaagctccacctgccaaagtgcca
gaggtacccaagaagcctgtgcctgagaagaaggtgccagttcctgctcctaagaaagtg
gaggctccacctgcaaaagtgccagaggtgcccaagaagctcatcccagaagaaaagaaa
ccaacacctgttccgaaaaaagtggaagcaccaccacccaaagtgccaaagaaacgtgaa
ccagttccagttcctgtagctctacctcaggaagaggaagttctatttgaagaagaaatt
gttcctgaagaggaagttctacctgaggaagaggaagttctacctgaggaagaggaagtt
ctacctgaagaagaggaagttctacctgaagaagaggaaattccacctgaggaagaggaa
gttcctcccgaagaagaatatgtacctgaggaagaagaatttgtacctgaagaagaagtc
cttccagaagttaaacctaaggtgccagtacctgcaccagtgcctgaaattaagaagaaa
gtgacagagaagaaagtggtcattcccaagaaagaggaggctccccctgccaaagttcct
gaggtgcctaagaaggtggaagaaaaacgaatcattctccctaaagaagaggaagttcta
ccagttgaagtgactgaggagcctgaagaagagcctatttcagaagaagaaatcccagaa
gaaccacctagcatagaggaagttgaagaggtggcaccacctagagtgcctgaagtgatt
aagaaagcagtacctgaagcacctactcctgttcctaaaaaagtggaggcaccaccagct
aaagtgtcaaagaaaattcctgaggaaaaagtacctgttcctgttcagaaaaaagaggca
cccccagccaaagtgcctgaagtaccaaagaaagtcccagaaaagaaagtccttgtgcct
aaaaaggaagctgttcccccagctaaagggagaactgtccttgaagaaaaagtatcagtt
gccttccgccaagaagtagtagtaaaagaaagactagaattagaagtagtagaagcagaa
gtggaagaaattccggaagaagaagagttccatgaagttgaagaatattttgaagaaggc
gagtttcatgaagtagaagaattcatcaaattagaacaacatagagttgaagaagaacac
agagttgaaaaagttcatagggtaatagaagtttttgaggctgaagaagtggaagtattt
gaaaaaccaaaagctccacctaaagggcctgagatatctgagaaaatcatccctccaaaa
aaaccgcccactaaagttgttcctcgaaaagagccaccagctaaagtaccggaggtgcct
aagaaaattgtggtagaagaaaaagtacgtgttcctgaagagcccagagttccaccaact
aaagtgcctgaagtgctgccaccgaaggaagtggtcccagaaaagaaagtaccggtgcct
cctgccaaaaagccagaagctccacctcctaaagtgcctgaggctcccaaagaagttgtt
cctgaaaagaaagtgccagtgcctcctcctaaaaagcctgaagtgccacccacaaaagtc
ccagaggtgccaaaggcagctgtcccagaaaagaaggtgcctgaagctattcctcccaaa
ccggaaagtcctccccctgaagtgccagaggctccgaaagaagttgttcctgaaaagaaa
gtgccagcggctcctcctaaaaagcctgaagtcacacctgttaaagtgcctgaggctccc
aaagaagttgttcctgaaaagaaagtgccagtgcctcctcctaaaaagcctgaagtgcca
cccacaaaagtcccagaggtgccaaaggtagctgtcccagaaaagaaggtgcctgaagct
attcctcccaaaccggaaagtcctccccctgaagtgttcgaggagcctgaggaagttgcc
ctagaagagcctcctgctgaagttgtggaagagccagagccagcggcgcctccacaagtg
accgtaccacctaagaaacctgtcccagaaaagaaagcacctgctgtcgttgccaaaaaa
cctgaactaccaccagtgaaagtgcccgaggtgcccaaggaggttgttcctgaaaagaag
gtgcctctggtggttcccaaaaagccagaagccccacctgctaaagtgcctgaagttcca
aaagaagttgttccagaaaagaaagtagctgttcccaaaaagccagaagtcccaccagca
aaagtgccagaagtgccaaagaaacctgtcttggaagagaaaccagctgttcctgttcca
gaaagagcggagtctcctcccccagaagtatatgaagaacctgaggaaattgctcctgaa
gaggaaattgctcctgaagaggaaaagccagttcctgttgcagaagaggaggaaccagag
gttccacctccagcagtgcctgaagagcccaagaagatcatcccagagaagaaagttcct
gtcatcaaaaaaccagaagcaccgcctcctaaagaacctgaacctgaaaaggttattgag
aagccaaaactcaaaccaagacccccacctcctccacctgctccacctaaggaagatgtg
aaggagaaaatattccaacttaaagctattccaaagaagaaagttcctgaaaaacctcag
gttccagaaaaagtggagcttacacctctgaaagtgcctggaggtgaaaagaaagttcgc
aaattacttccggaacgtaaacctgaaccaaaggaagaagttgttctgaaaagcgttcta
agaaaaagacctgaagaagaagaacctaaagtagaacctaaaaaactagaaaaagttaaa
aaacctgcagtaccagaaccaccacctccaaaacctgttgaagaggttgaagtacctact
gttacaaaaagggaaaggaagattcctgaaccaacaaaagtgcctgaaatcaagccagca
atacctctccctgcacctgaaccgaaaccaaagcccgaagcagaagtgaaaacaatcaaa
ccacctcctgtggaacctgaaccaacccccatcgctgccccagtaacagtgccagtggtt
ggaaagaaagcagaagccaaagcacctaaggaagaggctgccaagccaaaaggtcctatc
aaaggtgtacccaaaaagactccttcaccaatagaagccgaaaggagaaagttaaggcca
ggaagtggtggagagaaacctcctgatgaagccccgttcacctaccagctaaaggctgtg
ccactgaagtttgtgaaagaaatcaaagacatcatcttgacagaatcagagttcgttggc
tcttcagcaatctttgaatgtttggtctccccttccactgcaattacaacctggatgaaa
gacggtagcaatatccgtgagagtcccaagcacaggtttattgcagatggtaaagacaga
aagctgcacatcattgatgttcaactttccgatgctggtgaatacacctgtgttttacgt
ttgggaaacaaagaaaagacctccacggctaaacttgttgtagaagaacttcctgtgcgt
tttgtaaaaacactggaagaggaagtcacagtggtcaaaggacagccattgtacttgagc
tgcgagttaaacaaagagcgtgacgtggtctggaggaaggatggcaagattgtggtggag
aaacctggccgaattgtgccaggcgtcattggcttgatgcgggctctgaccatcaacgat
gcagatgacacagatgctggaacatacacagttactgtggaaaacgccaacaacctggag
tgttcatcttgcgtaaaagtagtagaagtcattagagattggctggtgaaacctatacga
gaccagcatgtgaaacccaaggggacagctatttttgcctgtgatatagcaaaagatact
ccaaacattaagtggttcaaaggatatgatgaaatccctgcggaaccaaatgataagact
gaaatactgagagatggaaatcatctgtacctcaaaattaagaatgctatgccagaagat
attgctgagtatgcagtggaaattgaaggaaaaagataccctgcaaagctgacacttgga
gagcgtgaagttgaactgcttaaaccaatagaggacgttaccatttatgagaaagaaagt
gcaagctttgatgcagaaatctcagaggcagacattcctggacaatggaaactgaaagga
gaacttctaaggccctcacctacttgtgaaatcaaagcagaaggtggaaaacgcttctta
actttgcacaaagtcaaactggaccaagctggtgaagtcctctaccaggcccttaatgca
attacaactgccattttgacagtaaaagaaatcgaacttgactttgctgtgcccctgaag
gatgtcactgttccagaaaggcgacaggctcgattcgaatgtgtcctcacccgagaggca
aatgttatatggtccaaaggacctgatataattaagtcatctgacaaatttgatatcatc
gctgatggaaagaaacatattcttgttattaatgattctcaatttgatgatgaaggggtc
tatactgctgaggtggagggcaagaagacctcagctcggttgtttgtcacaggtataaga
ctgaaattcatgtcacctcttgaagatcaaacagtaaaagaaggtgaaacagcaactttt
gtttgtgaactttctcatgaaaaaatgcatgtagtctggttcaaaaatgatgccaaactc
catacaagcagaacagtactcatctcttctgagggcaagactcacaaattggaaatgaaa
gaagtgacattggatgatatatctcagataaaagctcaagtcaaggagctgagctccaca
gcacagctgaaggtcttagaggccgatccctacttcactgtgaaattacatgacaaaact
gcagtggagaaggatgagattactttgaagtgtgaagtgagcaaagatgtaccagtgaaa
tggttcaaagatggtgaagagattgtcccttcacccaaatattctatcaaggcagatggc
ctgcgccgcatcttaaaaatcaaaaaggcggaccttaaagataaaggcgaatatgtgtgt
gactgtggcacagacaagaccaaggcaaatgttactgttgaggctcgactaataaaagtg
gaaaagcctctgtacggagtagaggtgtttgttggtgaaacagcccactttgaaattgaa
ctttctgaacctgatgttcacggccagtggaagctgaaaggacagcctttgacagcttcc
cctgactgtgaaatcattgaggatggaaagaagcatattctgatccttcataactgtcag
ctgggtatgacaggagaggtttccttccaggctgctaatgccaaatctgcagccaatctg
aaagtgaaagaattgcctcttatcttcatcacacctctcagtgatgttaaagtcttcgag
aaagatgaggctaagtttgagtgtgaagtatccagggagcccaaaacattccgttggcta
aaaggaacccaggaaatcacaggtgatgacagatttgagcttataaaggatggcactaag
cattcaatggtgatcaagtcagctgcttttgaagatgaagcaaaatacatgtttgaagct
gaagataagcacacaagtggcaaactgatcattgaaggaatccggctcaaattcctcacc
cctctcaaagatgtaactgccaaagagaaggaaagtgctgtatttactgtggagttatct
catgataacatccgagttaaatggttcaagaatgaccagcgcctacacaccaccaggtcg
gtctcaatgcaagacgaagggaaaactcattcgatcacattcaaagacctgtctattgat
gacacctcccaaattagagtagaagctatggggatgagttcagaagctaaactcactgtg
cttgagggagacccatattttacaggaaaacttcaagattatactggtgtagagaaagat
gaagttattctacagtgtgaaattagcaaagcagatgcaccagtgaaatggtttaaggat
gggaaggaaataaagccatccaaaaatgctgttattaaggcagatggcaagaaacgcatg
ctaatcctaaagaaagccttgaaatcagatattggacagtacacctgtgactgtgggaca
gataagacctcaggaaaacttgacattgaggatcgggaaattaaactggtgcgacccctg
cacagtgtggaggtgatggagactgagacagcacgctttgaaaccgaaatctctgaagat
gatatccacgccaactggaaactcaagggagaggccctactccaaacacctgattgtgaa
attaaggaagaaggcaaaatacactcccttgttttgcacaactgtcgcctggaccagacg
ggtggggtggatttccaagctgccaatgttaaatctagtgcccacctccgagttaagcca
cgagtaattggtcttctgaggcctttaaaggatgtcaccgtgactgcaggggaaacagcc
accttcgactgcgagctctcctacgaagatatcccagtggaatggtatctcaaagggaag
aaactagagcccagcgataaggtggtcccacgttcagaaggaaaagttcatacacttact
ctgagggatgtaaagttagaagatgctggggaagtccaactaacagcaaaagatttcaaa
actcacgccaacctctttgtgaaagaacccccagttgaattcactaagcctcttgaggac
cagacggtcgaagagggagccactgcagtgctggagtgtgaagtctccagagaaaatgct
aaggtgaaatggttcaaaaatgggacagaaatcctcaaaagcaagaagtatgaaattgtt
gctgatggcagggtcagaaaacttgttatacatgactgtaccccagaggatattaaaaca
tacacttgtgatgctaaggattttaagacttcctgtaacctgaatgtcgtgcctcctcat
gtggaattcttaagaccactcaccgaccttcaagttagagaaaaagaaatggctcgattt
gagtgtgaactttcccgagaaaatgctaaggttaagtggtttaaagatggtgctgaaatt
aaaaagggcaaaaaatatgacatcatatccaagggagcagtgcgcattcttgtcatcaac
aaatgtctactggatgatgaagctgaatattcctgtgaagtaaggacagcgagaacttct
ggcatgctgacagttctggaagaagaagctgtctttaccaaaaatcttgccaacattgaa
gttagtgaaacagacactataaaactggtttgtgaagtctccaaacctggcgcagaagtg
atttggtataaaggggatgaggagatcattgaaacaggaagatatgaaatactgactgaa
ggacggaagagaatcctggtcattcagaacgctcaccttgaggatgctggcaactacaac
tgtcgactcccaagctctcgaaccgatggcaaagtcaaagtacatgaactggctgctgaa
tttatctcaaagcctcaaaaccttgaaatacttgaaggagaaaaggctgaatttgtctgc
tctatatcaaaagaaagctttccagtccagtggaagagggatgataagacacttgaatct
ggagataaatatgacgttattgctgatggtaaaaagagggtcctagttgtgaaagatgcc
acattacaagatatgggcacttacgttgtcatggtaggggccgccagagcagcagctcac
ttgacagtcattgaaaaactcaggatcgtagttcctcttaaggacacccgggtgaaggaa
caacaggaagttgtcttcaactgtgaagtcaatactgaaggtgccaaagccaaatggttc
agaaatgaagaagctatatttgatagttcaaaatacatcattctccaaaaagacctagtc
tacaccctcagaattagagatgcacacttagatgaccaagccaactataatgtgtctttg
accaatcacagaggtgaaaatgttaaaagtgcagccaatctaatagtagaagaggaagac
cttaggattgttgagcctcttaaagatattgaaacaatggagaagaaatctgtcacattc
tggtgcaaggtgaatcgtctcaatgtaacactgaagtggaccaaaaatggtgaagaagtg
ccttttgacaaccgtgtctcatacagagttgataagtacaagcacatgttaaccattaaa
gactgtggcttcccagatgaaggtgaatacattgtcactgctggacaagataaatctgtt
gctgagcttctcatcatagaagccccgacagaatttgtggaacacttggaagatcagaca
gtcactgagttcgatgacgctgtcttctcctgccagctctccagagagaaagccaatgta
aaatggtacagaaatgggagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagat
ggaagtatacacagactcattataaaagattgcaggctggatgatgagtgtgaatatgct
tgcggggtagaagacaggaagtctcgtgctagactttttgtggaagaaattcctgttgag
atcatcaggcctccacaagatattcttgaagcccctggtgctgatgttgtctttttagca
gaactcaataaagataaggtggaagtccaatggctaagaaataacatggttgttgtccag
ggtgataaacaccagatgatgagtgaaggaaagatacatcgactacagatttgtgatatt
aagccccgtgaccagggtgaatacagatttattgccaaagacaaagaagccagagctaag
cttgaactggcagctgcaccaaaaatcaagacagctgaccaagaccttgtggttgatgtt
ggcaagcctctgacaatggtggtgccatatgatgcctaccccaaagcagaagctgaatgg
tttaaagaaaatgaacctttatctacaaaaaccattgatactacggctgaacaaacttct
ttcagaattttagaagccaagaaaggagacaaagggaggtataaaattgtgcttcagaac
aaacatggaaaagcagaaggattcatcaatttaaaagttattgatgttcctgggccagta
cgtaacttagaagtgacagaaacatttgatggtgaagtgagccttgcttgggaagaacct
ttaactgatggtggaagcaaaatcataggttacgttgttgaaagacgtgacattaagaga
aagacctgggttctggccacagaccgtgcagagagttgtgagtttactgtcactggtcta
cagaaaggaggagttgagtacctattccgtgtgagtgcaagaaacagagttggcactggt
gagccagtagaaactgacaatcctgtagaagcaaggagtaaatatgatgttccaggccct
cctttgaatgtaaccatcactgatgtgaatcgatttggtgtctcactgacatgggaacca
ccagagtatgatggaggtgctgagatcacaaactacgtcattgaattaagagacaagact
tctatcaggtgggatactgccatgactgtgagagctgaagacctgtctgcaactgttact
gatgtggtagaaggacaggagtacagtttccgagtgagagcccaaaatcgaattggagtt
ggaaaaccaagtgcagccacacccttcgtcaaagttgctgatccaattgagagaccaagt
cctcctgtaaacctaacttcctcagatcagactcagtcatcagttcagctcaaatgggaa
cctcctctgaaagatggaggaagcccaatattaggctatataattgagcgatgcgaagaa
ggaaaagataattggattcgttgcaatatgaaacttgtccctgaactgacttacaaggtt
accggattggaaaaaggaaataaatatttatatagagtatctgcagaaaataaagctggt
gtttcagatccatctgaaattcttggtcctctcaccgctgacgatgcatttgttgaacca
acaatggatttaagtgcatttaaagatggtctggaagttattgtcccaaatcctatcacg
atcctggttccaagtacaggctatccaaggccaactgcaacctggtgttttggagataaa
gtactagaaacaggggaccgggtgaaaatgaagaccttgtctgcctatgccgaacttgtc
atttctccaagtgaacgttcagacaagggcatttatacactgaaattagaaaaccgtgtg
aaaacaatttctggggaaattgatgtcaatgtaattgctcgcccaagtgcacccaaagaa
ttgaaatttggtgatataaccaaggactcagtacatttgacttgggaaccacctgatgat
gatggaggaagtccgttaactggatacgttgttgaaaaacgagaagtcagccggaaaaca
tggactaaagttatggactttgtgactgatctagaattcacagttcctgatcttgttcaa
ggaaaagagtacttatttaaagtttgtgctcgtaacaaatgtggccctggagaacctgca
tatgttgatgaacctgtaaatatgtcaactcctgcaacggtacctgacccaccagagaat
gttaaatggagagatcgaacagccaatagcatcttcttaacatgggatccacctaaaaat
gatggtggttcacgcatcaaaggatatatagttgaaagatgtccacgtggttctgataaa
tgggttgcctgtggagaacctgttgcagaaacaaaaatggaagtgacaggtcttgaggaa
ggcaaatggtatgcctaccgcgtgaaggccttaaacaggcagggtgctagcaaaccaagc
agacccacagaggaaatccaggctgtggacacacaagaggccccagaaatcttcctcgat
gtgaagctccttgctggtctcactgtaaaagctgggaccaagattgaacttcctgccacc
gtaaccggaaaacctgaacctaaaataacttggacaaaggctgatatgattctgaagcag
gacaaaagaattaccattgaaaatgtccctaagaaatccacagtgactattgttgatagt
aagagaagtgacactggcacatatatcattgaggctgtgaatgtgtgtggccgggccact
gctgtggtggaagtgaacgtcttagataaacccggaccaccagctgcctttgacatcaca
gatgtaaccaatgagtcatgtcttctaacatggaacccaccacgcgatgatggtggatct
aagatcacaaactatgttgtggagagacgagcaactgatagtgaagtgtggcacaagctc
tcatccaccgtcaaggatacaaacttcaaggccaccaaattaatccccaataaagagtac
atcttcagagttgctgcagaaaacatgtatggtgttggtgaaccagttcaggcctctcca
ataacagccaaatatcagtttgatccacctggtcctccaactcgcctagaaccttctgat
atcactaaagacgcagtgactctcacatggtgtgagccagatgatgatggtggcagccca
atcacaggatactgggttgaaagactggatcctgatacagataaatgggttagatgcaat
aagatgccagtaaaggacacaacatacagagtgaaaggtctcactaataagaaaaaatac
agattccgtgtgttggctgaaaatcttgctggacctggaaaaccaagcaaatcaactgaa
ccaatcttaataaaggatcccatagatcctccatggccccctggaaaaccaactgtaaaa
gatgtaggcaaaacatcagtaaggttgaattggacaaaaccagaacatgatggaggtgca
aagattgagtcttatgtcattgaaatgctgaagactggaacagatgagtgggtcagagtg
gcggaaggggttcccaccactcagcacttgctcccagggctcatggaaggacaggaatac
tcattccgagttagagctgtgaataaggctggggaaagtgaacccagtgaacccagtgac
cctgtgctttgccgggagaagctatatcctccatcaccaccacgctggcttgaagttatt
aatatcacaaaaaatacagcagacctaaaatggacagttcctgagaaagatggagggtcc
cccatcaccaactacattgtggaaaagagagacgtcaggcgaaaaggctggcaaacagtg
gataccactgtcaaggacaccaagtgcacagtcaccccactgactgagggctctttatat
gtgttccgagttgctgcagaaaatgctataggacaaagcgactacaccgaaattgaggac
tctgtgctggccaaagacacctttaccactcctggaccaccctacgccctggcagtggtt
gatgtgacaaaacgacatgttgacctaaagtgggagccacctaaaaatgatggtggaaga
ccaatacagagatatgtcattgagaagaaagaaaggttaggtacccgttgggtgaaagct
ggaaagactgcaggacctgactgtaacttcagagtaactgatgtcatcgaaggaacagag
gtccagtttcaggttcgggctgaaaatgaagctggagttggccacccaagtgaacccaca
gaaatcctatccattgaagatccaacaagtcctccctcaccaccccttgacctacatgtg
actgatgctgggagaaaacacattgccattgcttggaagcctccagagaaaaatggtgga
agtcctatcataggataccatgttgaaatgtgtccagtaggcactgagaaatggatgaga
gttaattctcgcccaataaaggacttgaaattcaaggttgaagaaggtgttgttcctgac
aaagaatatgtcctgagagtgagagcagtcaatgctattggtgtcagcgagccatctgaa
atctctgaaaatgtggttgccaaagacccagactgcaagccaacaattgacctggagact
catgacattattgttattgaaggtgaaaagttaagcattcctgttcccttcagagctgtc
ccagttccaactgttagttggcataaagatggcaaagaagttaaagcaagtgatagatta
acaatgaagaatgatcacatctctgcacaccttgaagttcccaagagtgtccgtgcagat
gccggaatttataccattacactggagaataagctcggctcagcaacagcctcaatcaat
gtcaaagtcataggcctacctggaccatgcaaagatattaaagcaagtgacattaccaag
agttcttgtaagttaacttgggaacctccagaatttgatggtggaaccccaattcttcat
tatgtcctggagcgcagagaagctgggaggagaacatatataccagtcatgtctggtgag
aacaaactgtcatggactgtgaaggatctcataccaaatggtgaatacttcttccgtgtt
aaagcagtcaacaaggttggtggaggagaatatattgaactgaaaaatccagtcattgct
caagatccaaagcaaccccctgatccacctgtagatgtagaggttcataatcctacagcg
gaggcaatgactattacatggaagccacctttgtatgatggagggagcaagataatgggc
tacatcatagagaagattgctaagggtgaagaaaggtggaagagatgcaatgaacacctg
gtaccaatcctgacctatacagcaaaaggacttgaagaggggaaagagtaccaattccgt
gtgcgagcagagaacgccgcgggtattagtgaaccttctcgggctactcctccaaccaaa
gctgtagatcccattgatgcccccaaagtcattctgagaacaagcctagaagtgaaacga
ggtgatgaaatagcacttgatgcaagtatttctggatcaccttacccaactattacatgg
ataaaggatgaaaatgttattgtaccagaggaaattaagaagcgtgcagcacccttggtt
aggagaaggaagggtgaagttcaagaagaagaaccatttgtcctgcctctgacacagcgt
ttgagtattgacaacagcaaaaagggagaatctcagctacgcgtccgagattctctccga
cctgaccatggtctgtatatgatcaaagttgaaaatgaccacggtattgcaaaagctcct
tgtactgtcagtgtgttagatacaccgggaccaccaatcaactttgtatttgaagatatc
agaaagacctcagtcctttgtaaatgggaaccaccccttgatgatggtggcagtgaaatc
ataaactacactttggaaaagaaagacaagacaaaacccgactcagaatggattgttgtc
acttcaacacttagacattgcaaatattcagtaacaaaactgattgaaggaaaagagtac
ctcttccgtgtaagagctgaaaacagatttgggccaggtccaccatgtgtttcaaagcca
cttgtggctaaagatccatttggaccacctgatgcaccagataagcccattgtggaagat
gttaccagcaacagtatgctagtgaaatggaatgaaccaaaagataatggaagccccatt
ttgggttactggcttgaaaaacgtgaagttaacagtacacattggtctcgtgtcaacaaa
agccttctgaatgccttgaaagccaatgtagatggcttattagaaggactcacctatgtc
ttcagagtatgtgctgaaaatgcagctggacctggaaagttcagtccaccttcagatccc
aaaacagcacatgatccaatctctcctcctgggccacctatcccaagagtcactgacaca
agctctacaactattgaactagaatgggaacccccagctttcaatggtggtggggaaatt
gttggctattttgttgataagcagttggttggcacaaatgaatggtcacgctgcacagag
aagatgatcaaggtccgtcagtacaccgtcaaagaaatccgagagggtgctgattacaaa
cttcgggtgagtgctgtcaatgccgcaggggaaggaccgcctggagaaacacaacctgtt
actgtggctgaaccacaagagcctccagctgtggaactggatgtttctgtcaagggtgga
atacaaataatggctgggaagactcttagaattccagctgtggtgactggtcgccctgta
cctacaaaagtatggaccaaagaagaaggggagctggataaagaccgtgttgtaatagac
aacgttggaaccaaatctgaactaattatcaaggatgcactgcgaaaagaccatggcaga
tatgtgattacagctacaaatagctgtggttccaaatttgcagcagccagggtagaagtt
tttgatgtccctggtccagttcttgacttaaaacctgttgtaacaaacagaaaaatgtgt
ctacttaactggtctgatccagaagatgatggaggaagtgaaataacaggctttatcatt
gaaagaaaagatgccaagatgcatacttggagacaaccaatagagactgagagatctaaa
tgtgacatcacaggtctgcttgagggacaagaatataagttccgtgttattgccaagaac
aagtttggctgtggccctcctgttgaaataggaccaattcttgcagttgatccactaggt
cctccaacatctccagagaggctcacatacactgaaaggacaaagtccactatcacactt
gactggaaagagccccgcagtaatggtggcagtcccatccaaggatatatcattgaaaaa
cggcgtcatgacaaacctgactttgaaagagttaacaagcgactctgcccaaccacatct
tttctggttgaaaatcttgatgaacaccaaatgtatgagttccgtgtcaaagctgtcaat
gaaattggtgaaagtgaaccatccctacctcttaatgtagtcatacaagatgatgaagtg
cctccaactattaagttgcgtctgagtgttcgaggagacactatcaaagttaaggcagga
gagcctgtccacatccctgcagatgtgacaggccttccaatgcctaagattgaatggtcc
aaaaatgaaactgtaattgaaaaacccactgatgcacttcagataaccaaggaagaggta
tcccgaagtgaggcaaaaactgagcttagcattcccaaagcggtccgggaggacaaaggc
acttacacagttactgcttccaatcgccttggctcagtgttccgaaatgttcacgttgaa
gtatatgaccgcccatccccaccaagaaatcttgctgttactgacattaaagctgaatct
tgctacttgacatgggatgcccctcttgataatggtggcagtgaaatcacccattatgtt
attgacaaacgtgatgcaagtaggaagaaagcagaatgggaggaagtcaccaacactgct
gtagagaaaagatatgggatctggaaacttatccccaatggtcagtatgagttccgagtc
agggcagtgaataaatatggaatcagtgatgagtgcaaatcagataaagtagtcattcaa
gatccttatcgccttcctggacctccaggaaaaccaaaagttttggcacgcaccaaagga
tcaatgctagtgagctggactcctcctttggacaatggtggctctccaattactggctac
tggctggagaaaagagaagagggaagtccttattggtcacgtgttagccgagcaccaata
accaaagtgggattgaaaggcgtggaatttaatgttcctcgtttgcttgaaggcgttaaa
taccagttcagagccatggcaataaatgctgcaggaattggtcctcccagtgaaccatca
gatccagaggttgcaggagatcccatatttccaccggggccaccttcttgcccagaagtt
aaagataaaacgaagtcaagcatctcactaggatggaaacctccagccaaagatggtggc
agcccaatcaaaggatacattgtagaaatgcaagaagaaggtactactgactggaaaaga
gtaaatgaaccagacaaacttataactacctgtgaatgtgtggtgcctaatctgaaagag
ctcaggaagtacagattcagagtgaaagctgtcaatgaagctggtgaatctgaaccaagt
gatacaactggggagatccctgccactgatattcaagaggaaccagaagttttcattgac
attggagcacaggactgtctggtttgtaaagctggctcacagattaggattcctgctgtc
atcaagggacgcccaacaccaaaatcatcttgggaatttgatggaaaggcaaagaaagca
atgaaggatggagttcatgacatacccgaagatgcacagctggagactgctgaaaactcc
tcagtaattattattccggagtgtaaacgatctcatacaggcaaatacagcatcacagcc
aagaataaagcaggacaaaagactgcaaattgcagagttaaagtcatggatgtaccaggc
ccacccaaagatctgaaagtcagtgatatcacaaggggtagttgcagactttcatggaag
atgccagacgacgatggaggagacaggatcaaaggctatgttattgagaagaggactatt
gatggaaaagcctggaccaaagtcaatccagactgtggaagcaccacatttgtagtgcct
gatctcctctctgaacagcaatatttcttccgtgtgcgagcagaaaaccgttttggtatt
ggcccacctgtggaaaccattcagaggaccactgccagagatccgatatatcctcctgat
cctcctattaaactcaagattggcctcatcacaaagaacacagtgcatctgtcatggaaa
cccccgaagaatgatgggggctcccctgttacccactatattgttgagtgccttgcatgg
gaccctactgggacaaagaaagaagcctggaggcagtgcaataagcgtgatgtggaagaa
ctgcaatttactgttgaagacctagtagagggtggggaatatgaattccgagtcaaagct
gtcaatgctgcaggagtcagcaagccttcagccactgttggccctgtgactgtcaaagac
cagacatgcccaccatcaattgatctaaaagaattcatggaggttgaagaaggaaccaat
gttaacattgtggccaaaattaaaggtgtgccattcccgacactaacctggtttaaagct
cctccaaagaagcctgataacaaagaacctgttctctatgacacccatgtcaacaaactg
gtggtagatgatacttgcactttagttattccgcagtctcgcaggagtgacactggctta
tataccatcacagctgtaaataatctgggaacagcatcaaaggagatgagactgaatgtc
ctgggtcgtcctggccctccagtgggacccataaaatttgaatctgtttcagcagatcaa
atgacactatcttggtttccacctaaagatgatggtgggtctaagattacaaactatgta
attgagaaaagagaagctaacaggaagacatgggtccatgtctccagtgaacctaaggag
tgcacgtacacgattcccaaattgctagaaggccatgaatatgtattccgaatcatggcc
cagaataaatatggcattggagaacctcttgacagtgaacctgaaacagcaagaaacctc
ttctctgtccctggagcaccagataaaccaacagttagcagcgtgactcgtaactccatg
actgtcaactgggaagagccagaatatgatggaggctctcctgtgacagggtactggctg
gaaatgaaagacaccacttcaaagagatggaagagagttaaccgagatcctatcaaagcc
atgactttgggtgtttcttataaagtgactggtcttattgaaggttccgactatcaattc
cgggtatatgcaatcaatgctgctggcgtgggtccagcaagtctgccatcagacccagcg
actgctagagatccaattgcccctcctggtcctccatttcccaaagtgacagattggact
aaatcatctgcagatctggagtggtctcccccactaaaagatggtggatccaaagtaact
ggatacatcgttgaatataaagaagaaggaaaagaagaatgggaaaagggtaaagataaa
gaagtgagaggaacaaagcttgttgtgacaggattaaaggaaggagcattctacaaattt
agagttagagcagtcaacattgctggcattggagaacctggagaggtcacagatgtcatt
gaaatgaaggacagacttgtttcacctgaccttcagctagatgccagtgtcagagataga
attgttgtccatgctggaggggtgatccgaatcattgcctatgtgtctggaaagcctcct
ccaaccgtcacctggaacatgaatgaaagaaccttacctcaagaagccaccattgagacc
acagccattagctcatccatggtcatcaagaactgccagaggagccatcaaggcgtctat
tctcttcttgccaaaaatgaagccggagaaagaaagaagacaattattgttgatgtatta
gatgttccaggtcccgttggaacaccattcctagctcacaacctaaccaatgagtcctgc
aaactgacatggttttctccagaagatgatggaggctctccaatcaccaattatgtcatt
gaaaagcgtgaatctgaccgcagagcatggaccccagtgacatatacagttacccgacaa
aatgctactgtccagggtctcattcaaggaaaagcctactttttccgaattgcggctgaa
aatagtattggcatgggtccatttgttgagacatcagaggcacttgttatcagagagcca
ataactgtaccagagcgtcctgaagacctggaagtcaaagaagttactaaaaatactgta
actttgacttggaatcctcctaagtatgatggtgggtcagaaattattaactatgtccta
gaaagtcggctcattgggactgagaagttccacaaagttacaaatgacaacttgcttagc
agaaaatacactgttaaaggcttaaaagaaggtgatacctatgagtaccgtgtcagtgct
gtcaacattgttggacaaggcaaaccatcattttgcaccaaaccaattacttgcaaggat
gagctggcacccccaacgcttcacctcgacttcagagataagctcacgattcgagttggt
gaagcttttgccctcactggccgttactcaggcaaaccaaagcctaaggtttcctggttc
aaagatgaagctgatgtgctggaagatgatcgcactcatataaagactacaccagcaaca
cttgctttagagaagatcaaggccaaacgttcagattccggcaaatactgtgtggttgtg
gagaacagtacaggctctaggaaaggtttctgtcaagttaatgttgttgaccgtcctgga
ccaccagtaggaccagttagttttgatgaggtgaccaaagattacatggttatctcttgg
aagcctcctttagatgatggaggcagtaaaatcaccaattatattattgagaagaaggaa
gtgggtaaagacgtctggatgccagtgacatctgcaagtgctaaaacaacatgcaaagtt
tctaaactacttgaaggaaaagattatattttccggatacatgctgaaaatctgtatgga
ataagtgatcctctggtgtctgattcaatgaaagccaaagatcgtttcagggttcctgat
gcacctgatcagccaattgttacagaagttaccaaagactctgcattagtaacctggaat
aagccacatgatggaggaaaacccatcacaaactacatcctggaaaagagagaaactatg
tctaaacgatgggctagagttaccaaagatcctattcatccatacactaaatttagggtt
cctgatcttctagaaggatgtcagtatgaattccgggtttctgcagaaaatgaaattggt
attggagatccaagcccaccatccaaaccagtctttgctaaagatccaattgctaaacca
agtccacctgttaatcctgaagcaatagatacaacatgcaattcagtcgatctaacttgg
cagccaccacgtcatgatggtgggagcaagattctgggttatattgttgagtaccagaaa
gttggagatgaagagtggagaagagccaatcacacccctgagtcatgtcctgaaactaaa
tataaagtcaccggtcttcgggacggtcaaacctataagtttagagtgttagcagtcaat
gcagctggtgaatcagatccagctcatgttccggagccagtcctagtaaaagacaggctt
gaaccccctgagttgattcttgatgccaacatggcaagagaacaacacattaaagttggt
gatactctaagacttagtgccatcatcaaaggagtgccattcccaaaagtaacttggaaa
aaagaagacagagatgctccaactaaagcaagaattgatgtgactccagttggtagcaag
cttgaaattcgtaatgctgcccatgaagatggtggaatttattctttaacagtggagaat
ccagctggttcaaaaactgtctcagtaaaagtacttgtattagataaacctgggccacct
agagatctggaagtcagtgaaattaggaaagattcatgttaccttacttggaaagaacca
ctggatgatggtggttctgttattaccaattatgtggttgagaggagagatgttgccagc
gcccagtggtcacctctctcagctacatcaaagaaaaagagtcacttcgctaagcatctg
aatgaaggcaaccagtacctcttccgagtagctgcggagaaccagtatggacgtggtcct
tttgttgaaacaccaaaaccaatcaaggctttggatcctctccatcccccagggccaccc
aaggacctgcaccatgtagatgttgacaagactgaagtctccctagtctggaataagccg
gatcgtgatggtggttctccaatcactggatatttggtagaatatcaagaagaaggcacc
caggactggattaaatttaagactgtgacaaacttagagtgtgtggttactggactacaa
caaggaaagacctatagattccgtgtaaaagctgaaaacattgtgggtcttggtctccct
gacacaactatcccgatagaatgtcaagaaaaactagtgcctccatccgtggagctagat
gtgaaattaattgaaggtcttgtggtaaaggctggaaccacagtcagattccctgctatt
ataagaggtgtgcctgttcctactgcaaagtggacaaccgatgggagtgagattaaaacc
gatgagcactacacagttgaaacagacaacttctcatcagtacttaccattaagaactgc
ttaaggagagacactggggaatatcaaatcacagtttccaatgcagccggtagcaaaaca
gtagccgtacatcttactgttcttgatgttcctgggccaccaacaggtcctattaatatt
ctggatgttactcctgaacacatgactatctcatggcagccacctaaggatgatggagga
agccctgtgataaattatattgttgagaaacaagatacaaggaaagacacgtggggtgtt
gtctcttccggaagcagtaagacaaagctgaaaatcccacatctgcagaagggctgtgaa
tatgttttccgagttagagcagagaataagataggtgttggtcctccccttgactccaca
cctactgttgctaagcataaatttagtcctccgtctcctcctggtaaaccagtggttact
gacattactgaaaatgcagcaacagtgtcttggaccctgccaaaatctgatggtggcagt
ccaataactggctactatatggaacgtcgagaagtaactggcaaatgggtgagggtcaac
aaaacacctatcgctgacctgaagttcagagtgactggactctatgaaggaaatacatat
gagtttagagtttttgctgaaaatcttgcaggactaagcaaaccatccccaagttctgat
ccaataaaagcttgccggcccatcaaaccacctggaccacctattaatcctaaactgaaa
gacaagagcagagaaacagctgatttggtgtggacaaagcctctcagtgatggtggtagc
cccattctaggatatgtagtggaatgtcagaaacctggcacagcacaatggaacaggatt
aataaagatgaactcattaggcaatgtgcctttagggtacctggactaattgaaggaaat
gagtacagattccgtataaaggcagctaatattgtaggagagggtgagccaagagaacta
gcagaatctgtgattgcaaaagatatccttcatcctccagaagtagaacttgatgttact
tgtcgtgatgttattaccgtgagagtaggccaaactatccgcattctagctcgagtcaaa
ggcagacctgaaccagacataacttggactaaggaaggcaaagtattggtccgagaaaag
agggtggaccttattcaggatctacctcgtgttgagttacaaattaaagaagctgttaga
gctgatcatggcaagtatatcatctcagctaagaacagcagtggacatgcccaaggttca
gccatcgttaacgtccttgacagacctgggccttgccagaatttgaaggttaccaatgta
accaaagagaactgtacaatttcttgggaaaacccactagataatggtggctcagaaata
acaaacttcatagtagaatatcgcaaaccaaaccagaaaggctggtcaattgttgcatca
gatgtcactaaacgattaatcaaggccaaccttttagccaacaatgaatactatttccga
gtttgtgcagagaataaagtaggtgttgggccaaccatcgaaacaaaaactcccattctg
gctattaaccctattgacagaccaggtgagcctgaaaaccttcacattgcagataaagga
aagacatttgtctatctaaagtggcggaggcctgactatgatggtggcagtccaaatctg
tcatatcatgttgagagaaggcttaagggctccgatgactgggaaagagtgcataaagga
agcattaaagaaactcactacatggttgacagatgtgttgaaaaccagatttatgagttc
agagtgcaaacaaagaatgaaggtggggaaagtgactgggtgaagacagaggaagttgtt
gtgaaagaagacttacaaaaaccagtacttgatctgaaattaagtggggtcctaactgtc
aaagcaggggacaccattaggcttgaggcaggggttagaggcaaaccattcccagaagtt
gcatggaccaaggacaaagacgctacagacttaacaagatcaccaagggtcaagattgat
acccgtgctgattcatctaaattttctcttactaaagcaaagcgaagtgatgggggtaaa
tatgtagttacggcaactaacacggctggcagttttgtggcctatgccactgtcaatgtt
ttagataagcctggtcctgtgagaaatctgaaaattgttgatgtgtccagtgataggtgt
actgtttgctgggatccaccagaagatgatggtggctgtgaaatccaaaattatattcta
gaaaaatgtgagacaaagcgaatggtttggtctacctattctgctactgtcttgacacct
ggtactacagtaacacgtctcatagaaggaaatgaatatattttcagagtccgtgcagaa
aataaaataggcacagggcctccaacagaaagtaaaccagtcatagccaaaaccaagtat
gataaacctggtcgccctgatcccccagaagtcactaaagtaagcaaagaagagatgact
gtggtttggaatccacctgaatatgatggtggaaagtctataactggatactttttggag
aaaaaggaaaagcattcaacacgatgggtccctgtcaacaagagtgcaatccctgagaga
cgtatgaaagtacagaatctcctcccagaccatgaatatcagttccgtgtcaaggcagaa
aatgaaattggaattggagaaccaagcttgccttcaagaccggtggtggcaaaagacccc
atagagccacctggtccaccaaccaatttcagagtggttgatacaaccaaacattccata
actcttgggtggggaaaaccagtctatgatggtggtgcaccgatcattggatatgttgtg
gaaatgagaccaaaaatagcagatgcgtctcctgatgaaggctggaaacggtgtaatgct
gcagcacagcttgtacgcaaggaattcactgttaccagcttggatgaaaaccaggaatat
gagttcagggtgtgtgcccaaaaccaagttggtattgggcgccctgcagagctaaaggaa
gctatcaaacctaaagaaatactagaacctccggagattgatttggatgccagcatgagg
aaactggtcatagtgagagcaggatgccctattcgtctctttgctatagtgagaggacga
ccagcccctaaagtcacttggcgaaaagttggcattgataatgtggtcagaaaaggacaa
gttgatctggttgacactatggccttccttgtcatccccaattctacccgtgatgactca
ggaaaatattccttaacacttgtgaacccagcaggagaaaaggctgtattcgtaaatgtc
agagtattagacactcctgggcctgtgtctgatttaaaagtttcagatgtcactaaaaca
tcatgccatgtgtcctgggcccctcctgaaaacgacggtgggagccaagtgacacattat
atcgtggagaaacgtgaggcagacagaaagacatggtcgaccgttaccccagaagttaag
aaaacaagcttccatgtaaccaatcttgtccctgggaatgagtattacttcagagtaact
gctgtcaacgaatatggccctggcgtcccaacagatgtcccaaaaccagtgcttgcatca
gatcctctaagtgagccggatcccccaaggaaattagaagtgactgaaatgaccaagaac
agtgccaccttagcctggttacctcccctacgtgatggaggtgctaaaatcgatggctac
atcactagttacagagaagaagagcagcctgcagatcgctggacagagtactcagtggta
aaagatctgagccttgttgtcactggcctaaaggaaggaaagaaatacaaatttagagta
gcggccagaaatgctgttggagtcagtttgccaagagaagctgaaggagtgtatgaagcc
aaagaacaactgttgccaccaaagatccttatgccagagcaaataactatcaaagctggg
aaaaaactccgaattgaagcccatgtgtatggaaagcctcatcccacctgtaaatggaaa
aaaggagaagatgaagttgtcacatccagccacctggcagtgcataaagcagacagctct
tcaattctgatcataaaagatgtgactaggaaagacagtggttactacagcctcacagca
gagaacagttctgggacagacactcagaaaatcaaagttgtagtcatggatgcccccggc
ccccctcagcctccatttgacatttctgatatagacgctgatgcttgctccctgtcatgg
cacatccctctggaggacggaggcagtaacatcaccaattatatagtggagaagtgtgat
gtaagccgaggtgactgggtcacggctctagcttcagtcacaaaaacttcctgcagggtt
ggaaagctgatcccaggccaggagtacatcttccgggtccgtgctgaaaaccgatttggc
atttcagagcctctcacatctccaaagatggttgcgcagttcccatttggtgttcctagt
gaaccaaagaatgcacgagtcaccaaagtcaacaaggactgtatttttgttgcttgggac
agaccagatagtgatggagggagccccattattggttatctgattgaacgcaaggaaaga
aacagtttgctgtgggtgaaagccaatgatactcttgtccggtcaactgaatatccttgt
gctggccttgtagaaggtcttgagtattcattcagaatctatgccctaaacaaagctgga
tccagcccacccagcaaacccacagaatatgtaactgcaagaatgccagttgatcctcct
gggaaacctgaggttattgatgtcaccaagagtactgtatctctgatctgggctcgtcca
aagcatgatggaggcagtaaaattattggctatttcgtagaagcttgcaaacttcctggt
gataaatgggtacggtgcaatactgcacctcaccagattccccaggaagagtacacagct
actggcctagaagagaaagctcagtatcaatttagagctattgccaggaccgcggtaaac
attagcccaccttctgaaccttctgatccagtgactatcctcgcagaaaatgtccctccc
aggatagacctgagtgtggctatgaaatctttgcttactgtgaaagctggaactaatgtc
tgcttggatgctactgtttttggtaaaccgatgccaacagtttcttggaaaaaagatggc
acactgctaaaaccagcagaaggcataaagatggccatgcagcggaatctgtgcaccttg
gagctattcagcgtgaaccggaaggactcaggagactataccattactgctgaaaattca
agtggttctaaatcagccaccattaagcttaaagtgttagataaaccgggtcctccagca
tctgttaaaatcaacaaaatgtattcagatcgtgctatgctttcttgggaaccgcctctt
gaagatggaggctcagaaatcaccaactatattgttgacaaacgtgaaacaagcaggccc
aactgggctcaagtctctgcaactgtgcctatcaccagctgcagcgtggagaaacttata
gagggccatgagtatcagttccgtatttgtgctgaaaataaatatggagtaggcgatcca
gtcttcactgaaccagcaattgccaaaaacccatatgacccaccaggacgctgtgatcct
cctgttattagcaacataaccaaagatcacatgacagtcagctggaagccaccagcagat
gatgggggctcacccatcactggctatttgcttgaaaagcgggaaacccaggctgttaac
tggactaaggtcaacagaaaacctattatagaaagaacattaaaagcaacaggtcttcaa
gaaggtaccgaatatgagttccgtgttacagctataaataaagctggaccaggcaaaccc
agtgacgcatccaaggccgcttatgctcgggaccctcagtatcctcctggcccaccggct
ttccctaaagtatatgatacaactcgcagctctgtgagtctatcttggggcaagccagcc
tatgacggcggcagccctatcattggttatctcgttgaagtaaaacgggctgactccgat
aactgggtgaggtgcaacttaccacagaatctacagaaaacccgctttgaggttactggc
ctgatggaagacacacaatatcaattccgtgtgtatgccgttaataagattggatacagt
gaccccagtgatgtgccagataaacactatcccaaggacatcttaattccacctgaggga
gaacttgatgcggacttaaggaagacactcatattacgtgctggagttactatgagacta
tatgtaccagtaaaaggacgcccacctccaaagattacttggtctaaaccaaatgtcaat
ctaagagacaggattggactggacataaagtcaactgactttgacactttcttgcgctgt
gaaaatgtgaacaaatatgatgcaggaaaatatatcttaaccctggagaacagctgtggt
aaaaaggaatataccattgttgtgaaagtgcttgatactcctgggccacctgtcaatgtg
actgttaaggaaatatccaaagactctgcttatgttacctgggagcctcccattattgat
ggcggaagccccatcataaactatgtggtacaaaaacgtgatgcagagaggaaatcctgg
tctacagtgacaactgagtgctccaaaacaagcttcagagtagctaatttggaggaggga
aaatcctacttcttccgagtgtttgctgaaaatgagtatggcattggtgatcccggtgaa
actcgtgatgctgtcaaagcttcccaaactcctggaccagttgtggacctgaaagtgagg
tctgtatctaagtcatcctgtagcattggctggaaaaagcctcacagtgatggtggaagt
cggattattggatatgtagttgatttcctgactgaagaaaataagtggcaacgagttatg
aaatccttaagcctacagtactctgcaaaagatttgactgaagggaaggaatataccttc
agagtgagtgctgagaatgaaaatggagaaggaaccccaagcgaaatcactgttgtggca
agggatgatgttgtggctcctgatcttgacttaaagggtctacctgatttgtgctacttg
gctaaagaaaacagcaacttccggcttaagatccccataaaaggcaagccagctccatca
gtctcctggaagaaaggggaagatcctctagcaactgacactagagtcagtgttgagtca
tctgcggttaacacaactcttatagtgtacgattgccaaaaatctgatgctggaaaatac
acaatcacacttaagaatgttgctggcaccaaggaaggaactatctccataaaggttgtt
ggcaagcctggcatccccactggaccaatcaaatttgatgaagtcacagcagaagccatg
accttaaagtgggctcctccaaaggatgatggaggttctgaaatcaccaactatatccta
gagaagagggattctgtgaacaacaagtgggtgacgtgcgcctcagctgtccagaaaacc
acctttagagtaaccagacttcatgagggcatggaatataccttcagggtcagtgccgaa
aataaatatggtgtaggggaaggcctgaaatcggagccaattgttgcgagacatccattt
gatgtgcctgatgctcccccacctcccaatattgtggatgtcagacacgattcagtatct
ctaacttggactgaccccaagaaaactggtggttctccaattacagggtatcatctcgag
ttcaaggaaagaaacagccttttgtggaagagagctaacaagactccgataaggatgaga
gactttaaagtgacaggattaactgaaggtcttgaatatgaattccgagttatggcaatc
aatttagcaggtgtgggcaagccaagcctaccatcagagcctgttgtggcactggaccca
attgatcctcctggaaaacctgaggttattaacataacaaggaattcagtgactctcatt
tggactgaacctaaatatgacggtggtcataagttaactggatatatagtggagaagcga
gatctaccttcgaagtcttggatgaaagccaaccatgttaatgtcccagaatgtgccttt
actgtaactgaccttgttgagggtggaaaatatgaattcagaattagagcaaagaataca
gcaggtgctatcagtgctccatcagaaagtacagaaaccattatttgcaaggatgaatac
gaggcaccaacaattgtccttgatcccacaataaaagatgggctaacaattaaagcaggg
gataccattgttttgaatgccattagcattcttggcaaaccccttccaaaatcaagttgg
tccaaggcaggaaaagacattagaccatcagatatcactcagataacttcaaccccaaca
tcttccatgcttactatcaagtatgccactagaaaagatgcgggtgaatataccatcact
gctaccaatccttttggcacgaaggtggaacatgtgaaggtaacagtccttgatgtacct
ggtcccccaggtcctgttgaaatcagtaatgtttctgctgaaaaagcaacacttacatgg
acacctcccttggaagatggcggctcaccaattaagtcctatatacttgaaaagagagaa
accagccgacttttgtggacagtggtttctgaagatattcagtcttgcaggcatgtggca
accaaacttatccaaggaaatgagtacatcttccgggtctcagctgtaaaccactatggc
aaaggagaacctgtacagtctgaacctgtcaaaatggtagacagatttggtccccctggc
cctcctgaaaaaccagaggtatcaaatgtcactaagaacactgccactgtcagctggaaa
aggccagtggatgatggtggcagcgaaattacaggatatcatgtagaaaggagagaaaag
aaaagcctgcgatgggtgagagcaataaaaacaccagtttccgatctcaggtgcaaagta
acaggactgcaagaaggaagcacctacgaattccgtgtcagtgcagaaaacagagcagga
attggtccacccagtgaggcttcagattctgttctgatgaaagatgcagcatatcctcca
ggaccaccttcaaatccgcatgtcactgatactaccaagaaatctgcttctttggcatgg
ggcaagcctcattatgatggtggacttgaaatcactggctatgtcgtggagcatcaaaaa
gtaggagacgaggcctggataaaagataccacaggaaccgccctcagaatcactcagttc
gttgttcctgatcttcagactaaagaaaaatacaacttcagaatcagtgccatcaacgat
gcaggtgttggggagccagcggtgattccagatgttgaaatcgtagaacgggagatggct
cctgattttgaactagatgccgagcttcgaagaacacttgttgttagagcaggactcagt
attaggatatttgtgccaattaaaggtcgtcctgctcctgaagtgacatggaccaaagat
aacatcaacctgaaaaaccgagccaacattgaaaatacggaatcatttactcttctgatt
atcccagaatgtaacagatatgataccggtaaatttgtcatgaccattgaaaacccggct
gggaagaaaagtggctttgtgaacgtcagagtcttggacacgccaggcccagtcctcaac
ctgcggcctacagacatcacaaaggacagtgtcaccctgcactgggacctccctctgata
gatggaggctcacgtataacaaactacattgtagagaaacgtgaagcaacacggaaatct
tattccacagccaccactaagtgccataaatgcacatataaagttaccggcttgtctgaa
gggtgtgaatatttcttcagagtgatggcagagaatgaatatggaattggtgagccaaca
gaaactacagagcccgtaaaagcctctgaagcaccatctccaccagacagccttaacatc
atggacataactaagagcaccgtcagcctggcatggcctaagcccaaacacgatggtggc
agcaagatcactggctatgtgattgaagcccaaagaaaaggctctgaccagtggacccac
atcacaaccgtgaaagggttagaatgtgttgtgaggaatctaactgaaggagaggaatat
accttccaagtgatggcagtgaacagcgcggggagaagtgcccctagagaaagcagaccc
gtcattgtcaaggagcagacaatgcttccagagctggatctccgtggcatctatcagaaa
ctggtcattgccaaagctggtgacaacatcaaagttgaaattccagtgctcggtcgaccg
aagcccacagtgacatggaaaaaaggagaccaaattcttaaacagacacagagagttaat
tttgaaaccacagcgacttcaaccattttaaatatcaatgagtgtgtcagaagtgatagt
gggccctatccattaacagcaaggaacattgtaggagaggttggtgatgtcatcaccatt
caagtccatgatatcccagggccacctactggaccaatcaaatttgatgaagtttcatct
gattttgtaaccttctcttgggacccacctgagaacgatggtggtgtaccaataagcaac
tatgtagtggaaatgcggcagactgacagtactacctgggttgagttagcaaccaccgtt
atacgtactacctataaagccacccgccttactactggattagagtatcagttccgtgta
aaagctcagaatagatatggagttggaccaggcatcacatcagcatgcatagttgccaac
tatccatttaaggttcctggacctcctggtacccctcaggtaactgcagttaccaaggat
tcaatgacaattagctggcatgagccactttctgatggtggaagccccattttaggatat
catgttgaaagaaaagaacgaaatggtattctctggcagactgtgagcaaagctttagta
ccaggcaacattttcaaatcaagtggacttacagatggtattgcttatgagttccgggtg
attgcagaaaacatggcaggcaaaagtaagccaagcaagccatcagaacctatgttggct
ctggatcccattgacccacctggaaaaccagtacctctaaatattacaagacacacagta
acacttaaatgggctaagcctgaatatactgggggctttaaaattaccagttatatcgtt
gaaaagagagaccttcctaatggacggtggctgaaggccaacttcagcaacattttggag
aatgaatttacagtcagtggcctaacagaagatgctgcatatgaattccgtgtgatcgcc
aaaaatgctgcaggtgccatcagtccaccatctgagccatctgatgctatcacttgcagg
gatgatgttgaggcaccaaagataaaggtggatgttaaatttaaggacacggttatatta
aaagcaggtgaagcattcagactggaagctgatgtttcaggccgcccacctccaacaatg
gaatggagcaaagatggaaaagagctggaaggcacagcaaagttagaaataaaaattgca
gatttctctactaatctggtaaacaaagattcaacaagaagggatagtggtgcctatacc
cttacagcgactaatcctggtggctttgctaaacacattttcaatgtcaaagttcttgac
agaccaggcccacctgaaggacctttggctgtaactgaagtgacatcagaaaagtgtgta
ctatcatggttccctccactggatgatggaggtgccaaaattgatcattacatagtacag
aaacgtgaaaccagcagattggcatggacaaatgtagcctcagaagtccaagtaacaaag
ctaaaggtcactaaactcttgaaaggcaatgaatacatattccgtgtcatggctgtaaat
aaatatggagtgggagagccactggaatcagagcctgtgcttgcagtgaatccttatgga
ccccctgatccgcccaaaaaccctgaagtgacaactattactaaagattcgatggttgtc
tgctggggacatcctgattctgatggtggaagtgaaatcatcaattatattgtggaacgg
cgtgataaagctggccaacgctggattaaatgcaacaaaaaaactcttactgatttaaga
tataaagtgtctggactgacagaaggacatgaatatgagttcaggattatggctgaaaat
gctgctggaattagtgcaccaagtcctaccagtccattttacaaggcttgtgacactgtg
tttaaacctggaccaccaggtaacccacgtgttctggatacaagcagatcatccatttca
atcgcttggaataaacctatctatgatggtggttcagaaatcactgggtatatggttgag
attgccctgccagaggaagatgaatggcagattgtcactccaccagcaggactcaaggca
acttcgtatactatcactggcctcacagagaatcaggaatataagatccgcatctatgcc
atgaattccgaaggacttggggaacctgcccttgttcctggaactccaaaggctgaagac
agaatgctgcctccagaaattgaactggatgctgacctgcgcaaagttgttactataagg
gcctgctgcaccctgagactttttgttcccatcaaaggaaggcctgcacctgaggtgaag
tgggcccgggaccatggagaatctttagataaagctagcatcgaatccacaagctcttac
accctgcttattgttggaaatgtaaacagatttgacagtggcaaatatatactaactgta
gaaaatagttcaggcagcaagtctgcatttgtcaatgttagagttctcgatacaccaggc
cccccacaggatctgaaggtaaaagaggtcactaagacatctgtcacactcacatgggac
ccacctctccttgatggaggttcaaaaatcaagaactatattgttgaaaagcgggaatca
acaagaaaagcatattcaactgttgcaacaaactgccacaagacttcctggaaggtagac
cagcttcaagaaggctgtagctactatttcagggttctcgcagaaaatgaatatggcatt
gggctgcctgctgaaaccgcagaatctgtgaaagcatcagaacgacctcttcctccagga
aaaataactttgatggatgtcacaagaaatagtgtgtcactctcttgggagaaaccagag
catgatggaggcagccgaattctaggctacattgtggagatgcagaccaaaggcagtgac
aaatgggccacgtgtgccacagtcaaggtcactgaagccactatcactggattaattcag
ggtgaagaatactctttccgtgtttcagctcagaatgaaaagggcatcagtgatcctaga
caactgagtgtgccagtgatcgccaaagatcttgtcattccaccagccttcaaactcctg
ttcaatactttcactgtactggcaggtgaagacctaaaagttgatgttccattcattggc
cgccctaccccagctgtaacctggcataaagataatgtaccactgaagcagacaactaga
gtaaatgcagagagcacagaaaataattcactactgacaataaaggacgcctgccgagaa
gatgttggccattatgtggttaaactgactaactcagctggtgaagctattgaaaccctt
aatgttatcgttcttgacaaaccagggcctccaactggaccagttaaaatggatgaagtg
acagctgatagtattactctttcctggggcccacccaagtatgatggtggaagttctatc
aataattacattgttgagaaacgggacacttccacaaccacctggcaaattgtatcagct
acagttgcaaggacaacaataaaggcttgcagactgaagactggatgtgaatatcagttt
agaattgcagctgaaaacagatatgggaagagtacctacctcaattcagagcctactgta
gcccaatatccattcaaagttcctggtcctcctggcactccagttgtcacactgtcctcc
agggacagcatggaagtacaatggaatgagccaatcagtgatggaggaagtagagtcatt
ggctatcatctagaacgcaaggaaagaaatagcatcctctgggttaagttgaataaaaca
cctattcctcaaaccaagtttaagacaactggccttgaagaaggtgttgaatatgaattt
agagtctctgcagagaacatcgtgggcattggcaagccgagtaaagtatcagaatgttat
gtggctcgtgacccatgtgatccaccaggacggccagaggcaatcattgtcacaaggaat
tctgtgactcttcagtggaagaaacccacctatgacggtggaagcaagatcactggttat
attgttgagaagaaagaattacctgagggccgttggatgaaagccagttttacaaatatt
attgacactcattttgaagtaactggcctagttgaagatcacagatatgagttccgggtt
atagcccgaaatgccgcaggagtgtttagtgagccttcagaaagcacaggagcaataaca
gctagagatgaggtagatccaccacgaataagtatggatccaaaatacaaagacacaatc
gtggttcatgctggtgaatcattcaaggttgatgcagatatttatggcaaaccaatacca
accattcagtggataaaaggtgatcaggagctttcaaacacagctcgattagaaataaag
agcaccgactttgccaccagtctcagtgtaaaagatgcagtacgtgtcgacagtggaaat
tacatactgaaggccaaaaatgttgcaggagaaagatcagttactgtgaatgtcaaggtt
cttgacagaccagggccacctgaaggacctgttgttatctcaggagttacagcagaaaaa
tgcacactagcttggaaacccccacttcaggatggtgggagtgacatcataaattatatt
gtggaaaggagagaaaccagccgcttagtttggactgtggttgatgccaatgtgcagact
ctcagctgcaaggttactaagcttcttgaaggcaatgaatatactttccgtataatggca
gtaaacaaatatggtgttggtgaacctcttgaatctgagccagtagttgccaagaatcca
tttgtagtaccagatgcaccaaaagctccagaagtcacaacagtgaccaaggactcaatg
attgttgtatgggaaagaccagcatctgatggtggtagtgaaattcttggatatgttctt
gagaaacgggataaagaaggcattagatggacaagatgccataagcgtctgattggagag
ttgcgcctgagagtaactggactcatagaaaatcacgattatgagttcagagtttctgct
gagaatgctgctggacttagtgaaccaagccctccttctgcttaccaaaaggcttgtgat
cctatttataaaccaggacccccaaacaaccccaaagtcatagacataaccagatcttca
gtattcctttcttggagcaaaccaatatatgatggtggctgtgaaattcaaggatacatt
gttgaaaaatgtgatgtgagtgttggtgaatggacaatgtgcactccaccaacaggaatt
aataaaacaaacatagaagtagagaagctgttggaaaagcatgaatacaacttccgtatc
tgtgctattaataaagctggagttggagaacatgctgacgtccctggacctattatagtt
gaagaaaaattagaagcaccagacattgatcttgacctagaactaaggaaaatcataaat
ataagggcaggtggctccttaaggttatttgttcctataaaaggtcgtcctacaccagaa
gttaaatggggaaaggtggatggtgaaatccgagatgcagctataattgatgtcactagc
agtttcacctctcttgttcttgacaatgtcaaccgatatgatagtggaaaatatacgctt
acattagaaaacagcagtggaacaaagtctgcctttgttactgtgagagttctggacacg
ccaagtccacctgttaacctgaaagtcacagaaatcaccaaagactcagtatcaattaca
tgggaacctcctttgttggatgggggatccaaaataaaaaattacattgttgagaaacgt
gaagccacaagaaaatcatatgctgctgttgtaactaactgccataagaattcttggaaa
atcgatcagctccaagaaggttgcagttattactttagagtcacagctgagaatgagtat
ggtattggccttcctgcccagactgctgatccaattaaggttgcagaagtgccacaacct
cctggaaaaataactgtggatgatgtcaccagaaacagtgtctctctgagttggacaaaa
cctgaacatgatggtggcagtaaaatcattcagtatattgtggaaatgcaagctaaacac
agtgagaaatggtcagagtgtgctcgagtaaagtctcttcaggcagtaattaccaaccta
actcaaggggaagaatatctttttagagttgttgctgtaaatgaaaaggggagaagtgat
cctcggtcccttgcagttccaatagttgccaaagatctggtaattgagccagatgtaaaa
cctgcattcagtagttacagtgtacaggttggccaagatttgaaaatagaagtgccaatt
tctggacgtcctaagccaaccattacctggactaaagatggtctcccactgaagcagacc
acaagaatcaatgttaccgattcactggatctcaccacactcagtattaaagaaactcat
aaggatgatggtggacaatatggaatcacagttgccaatgttgttggtcagaagacagca
tccatcgaaattgtaactctagataaacctgatcctccaaaaggacctgttaaatttgat
gacgtcagtgctgaaagtattacattatcttggaaccctccattatatacagggggctgc
caaatcaccaactacattgttcagaaaagagatacaaccaccacagtatgggatgttgtt
tctgctactgttgctagaactacactcaaagtgaccaaactgaaaactggtacagaatac
caatttagaatatttgccgaaaacagatatggacaaagctttgccttagagtctgatcca
attgtagctcaatatccctacaaagaaccaggccctccaggtacaccatttgccacagcc
atttccaaagactccatggtcatacagtggcatgaaccagtcaacaatggtggaagcccc
gtcataggttaccacctggagagaaaagaaagaaacagtattttgtggacaaaggtcaac
aaaactattattcatgacacccaattcaaagcacagaatcttgaagaaggcattgaatat
gaattcagagtgtatgctgaaaatattgttggtgtaggcaaagcaagcaagaattctgaa
tgctatgtagccagagatccctgtgacccaccaggaaccccagaaccaataatggttaaa
agaaatgaaatcactttacagtggaccaaacctgtgtatgatggtggaagtatgattaca
ggctacattgtagagaaacgtgatttgcctgatggtcgttggatgaaagctagctttaca
aatgtcattgaaactcaatttactgtgtcaggtcttactgaagatcaaagatatgaattc
agagtcattgcaaagaatgcagctggtgcaataagtaaaccctctgacagtactggacca
ataactgccaaggatgaggttgaactcccaagaatttcaatggatccaaaattcagagac
acaattgtggtaaatgctggagaaacattcagacttgaggctgatgtccatggaaagccc
ctacctaccattgagtggttaagaggagataaggaaattgaagaatctgctagatgtgaa
ataaagaacacagatttcaaggctttacttattgtaaaagatgcaattagaattgatggt
gggcagtatattttaagagcttccaatgttgcaggttctaagtcattcccagtaaatgta
aaagtattagatagaccaggacctccagaagggccagtccaggttactggagtcacttct
gaaaaatgctctttaacatggtctccaccacttcaagatggtggcagtgacatttctcac
tatgttgttgaaaagcgagaaaccagtcgacttgcctggactgttgttgcttcagaagtt
gtgaccaattctctgaaagttaccaaactcttagaaggtaatgaatatgttttccgtata
atggctgtcaacaaatatggtgttggagagcctttggaatctgcaccagtactaatgaaa
aatccatttgtgcttcctggaccaccaaaaagcttggaagtcacaaatattgccaaagac
tccatgaccgtctgttggaaccgtccagatagtgatggtggaagtgagattattggttac
attgtagagaaaagagacagaagtggcattcgatggataaaatgtaataaacgccgcatt
acagatttgcgtctaagagtgacaggattaacagaagatcatgagtatgaattcagggtc
tctgcagaaaatgctgctggagttggggaaccaagtccagctacagtttattataaagcc
tgtgatcctgtgttcaaacctggcccacctaccaatgcacacattgtagacaccactaaa
aattcaatcacacttgcctggggtaaacccatctatgatggcggcagtgagatcttggga
tatgtagtagaaatctgtaaagcagatgaagaagaatggcaaatagttactccacagact
ggcctgagagtcactcgatttgaaatttcaaaactcactgaacaccaagagtataaaata
cgagtctgtgccctcaacaaagttggtttaggtgaggctacatcagttcctggtactgtg
aaaccagaagataaacttgaagcacctgaacttgaccttgactccgaattaagaaaagga
attgttgtaagagctggtggatctgccagaattcacattccattcaaaggtcgtccaacg
cctgagatcacttggtctcgagaggaaggtgaattcacagataaggtccaaattgaaaag
ggagtaaactatacccaactatcaatagataactgtgatagaaatgatgctggaaaatac
attcttaagttggaaaacagcagtggatcaaagtctgcttttgtaactgtgaaagttctt
gacactccaggaccaccacagaatttggcagtcaaagaagtgagaaaagattctgccttc
ctggtatgggagccacccatcattgatggaggggcaaaggtcaagaactatgtgattgac
aaacgtgagtcaaccagaaaagcgtatgctaatgtgagtagtaaatgcagcaaaacaagt
tttaaagtggaaaaccttacagaaggagccatttattacttcagagtcatggctgaaaat
gaatttggagttggtgttccagtggaaactgttgatgccgtgaaagctgctgaacctcct
tccccaccaggaaaggttacactcactgatgtgtcccagaccagtgcatcacttatgtgg
gagaaacctgaacatgatggcggtagcagagtcctggggtacgttgttgaaatgcagccc
aaaggaactgaaaaatggagcattgtggctgaatccaaagtctgtaatgcagttgttact
ggtttgagttctggacaagaatatcagttccgtgtcaaggcttataatgagaaaggaaaa
agcgatccaagagtgttgggtgttcctgtcatagccaaggacttgactatacagcctagt
ttaaagttaccatttaacacatatagtatccaagctggagaagatcttaaaatagaaatt
ccagttataggccgaccaagacctaacatttcttgggtcaaagatggtgagcctcttaaa
cagacaacaagagtaaacgttgaagaaacagctacctcaactgttttgcacattaaagaa
ggtaacaaagatgactttggaaaatacaccgtaacggcaacaaatagtgcaggcacagca
acagaaaatctcagtgttatcgttttagaaaagcctggacctccagttggcccagttcgg
tttgatgaagttagtgcagactttgtagtcatatcttgggaacctccagcctatactggt
ggctgccaaataagcaactacattgtagagaagcgagatacaaccaccaccacttggcac
atggtatcagcaacagttgcaagaacaacaattaaaataaccaaactgaaaacaggcacg
gagtaccagtttagaatttttgctgaaaacaggtatggaaaaagtgccccactggattct
aaggcagttattgtacaatatccatttaaagaacctggaccacctggaactccttttgtg
acatcaatctcaaaagatcagatgcttgtgcaatggcatgagccagtgaatgatggaggc
accaaaattattggctaccatcttgaacagaaagaaaagaacagtattttatgggtcaag
ttaaataagacccccattcaggacaccaaattcaaaacaactgggcttgatgagggcctt
gagtatgagttcaaagtttctgctgaaaatattgttggcattggcaagcctagcaaagtg
tcagaatgctttgttgctcgtgatccatgtgacccacctggtcgccctgaagccattgtt
attacaagaaacaatgtcacactgaaatggaagaaacctgcctatgatggtggtagcaaa
ataacaggttatattgtagaaaagaaagatctacctgatggccgctggatgaaagccagc
tttaccaacgtattagaaactgaatttacagtgagtggacttgtagaagaccaaagatat
gaatttagagtaattgcaagaaatgcagctggaaactttagtgaaccatctgatagtagt
ggtgccattactgcaagagatgaaattgatgcaccaaatgcctctctggatccaaaatat
aaagatgtcatcgttgttcatgcaggagagacttttgttcttgaagccgacatccgtggc
aaacctatacctgatgttgtttggtcaaaagatggaaaagaacttgaagaaacagctgct
agaatggaaattaaatctactattcagaaaacaactcttgttgtcaaagactgtatacgg
actgatggaggacaatatattctgaaactcagcaatgttggtggtacaaagtctataccc
atcactgtaaaggtacttgacaggccagggcctcctgaagggcctctgaaagttactgga
gttactgcggaaaaatgttacctggcatggaacccacctttgcaagatggtggtgctaat
atttcacattacatcattgaaaagagggagacaagccgactctcttggacccaggtttca
actgaggtacaggcccttaactacaaagttactaaacttcttcctggtaatgagtacatt
ttccgtgtcatggctgtgaataaatatggaattggagagcccttggaatctgggcctgtt
acggcctgtaatccttataagccaccaggtcctccctcaacacctgaagtctcagcaatc
accaaagattctatggtagtaacatgggcacgcccagtagacgacggaggtaccgaaatt
gagggctacattcttgaaaaacgagataaggaaggcgttagatggaccaagtgcaacaag
aaaacattaacggatctgcggctcagggtaactggtcttaccgaaggccattcctatgaa
ttcagagttgctgctgaaaatgcagctggtgtgggagaacctagtgagccatctgttttc
taccgtgcgtgtgatgccttgtatccaccaggtcccccaagcaatccaaaagtgacggac
acttccagatcttctgtctccctggcatggagtaagccaatttatgatggtggcgcacct
gttaaaggctatgttgtagaggtcaaagaagctgctgcggatgaatggacaacctgcact
ccaccaacaggattacaaggaaagcagttcacagtgaccaagcttaaagaaaacactgaa
tataacttccgtatttgtgccatcaattctgaaggtgtaggtgaacctgcaactctacct
ggctcagtggttgctcaggagaggatagagccaccagaaatagaactcgatgctgatctc
agaaaggtggtcgttctgcgtgcaagtgctactttacgcttatttgtcactatcaaaggt
cgaccagaacccgaagttaaatgggaaaaggcagaaggcattctcactgacagggctcag
atagaggtgaccagctcatttacaatgttggtgattgataatgttaccagatttgacagt
ggtcggtataatctgacattagaaaataatagtggctccaaaacagcttttgttaacgtc
agagttcttgactcaccaagtgcccctgtgaatttgaccataagagaagtgaagaaagac
tcagtgacgttgtcctgggaaccaccacttattgatggtggagctaagattacaaactac
attgtcgaaaaacgagaaactacaagaaaagcctatgctaccattacaaataattgcact
aaaactactttcagaattgaaaatctacaagaaggatgttcttactacttccgagtcttg
gcttccaatgaatatgggattggtttgccagctgaaacaacagaacccgttaaagtgtct
gaaccacccctcccacctggaagagtaactcttgttgatgtgacccgtaatacagctaca
attaagtgggagaaaccagaaagtgatggtggcagcaaaattactggttatgtggttgaa
atgcagactaaagggagtgaaaagtggagcacctgcacacaagttaagactctagaagca
actatatctggcttaactgcaggagaagagtatgtcttcagggtagctgcagttaacgaa
aagggaagaagtgatccaagacaacttggagtgccagtaattgcaagggatattgaaata
aagccttcagttgagcttcctttccatactttcaatgtaaaggctagagaacaacttaag
attgatgtgccattcaaaggaagacctcaagctactgtgaactggagaaaagatggtcag
actcttaaagagacaactagagtcaatgtttcttcttcaaagactgtaacatcactatct
attaaggaagcttcaaaggaagatgttggaacttatgaattatgtgtttcaaacagtgct
ggatccataacagttcctattactataattgtccttgacagaccaggacctccaggtcct
atacgtattgatgaggttagttgtgacagcataaccatttcttggaatcctccagaatat
gatggtggctgccaaattagcaattacattgttgaaaagaaagaaaccacctctacaaca
tggcacatagtttcacaagcagttgcaagaacatccattaaaatagttcgcctgacaaca
ggaagtgagtatcagttccgtgtttgtgcagaaaaccgctatggaaagagctcctacagt
gaatcttcagctgttgttgcagagtatccattcagtcccccaggtcctcctggtactcct
aaagttgtgcatgccacaaaatctaccatgcttgtaacctggcaagtgccagttaatgat
ggaggaagtcgagtaattggctatcatcttgagtataaagaaagaagcagcattctttgg
tcaaaagcaaataaaatcctcattgctgatactcaaatgaaagtctccggccttgatgaa
ggactgatgtatgagtatcgtgtatatgctgaaaatattgctggaattggtaaatgcagt
aaatcttgtgaaccagtccctgcaagagatccttgtgaccctcctggacaacctgaagtc
acaaatatcacaagaaaatcagtgtcacttaaatggtctaaaccacattatgatggtgga
gctaagatcacaggatacattgttgaacgcagagaactaccagatggccggtggctgaag
tgcaattatactaatatacaagaaacatactttgaagtaactgaacttactgaagatcag
cgttatgaattccgggtttttgcaaggaatgctgctgactcagttagtgagccatctgaa
tccactgggcctattatagttaaagatgatgttgagcctccaagagttatgatggatgtc
aagttccgagacgttattgttgtcaaagctggagaggtccttaagataaatgcagacatt
gcagggcgacctctgccagtaatttcctgggccaaggatggtatagaaattgaagaaaga
gcaagaacagaaatcatctcaacagacaatcatactttgttaacagttaaagactgtata
agacgagacactgggcaatatgtactaacactgaagaatgttgccggcactcggtctgtg
gccgttaattgcaaagtacttgataagcctggtccaccagcaggaccacttgaaataaat
ggcctcactgctgagaaatgctctctttcctggggacgtccccaagaagatggtggtgca
gatatcgactattacatcgtagaaaaacgtgaaacaagccaccttgcatggacaatatgt
gaaggagagttacagatgacatcctgtaaagtaaccaagttactcaaaggcaatgaatat
atatttagagtaactggtgttaataaatatggtgttggtgagcccctagagagtgtagct
ataaaggcactagatccatttacagttccaagtccacccacgtctttggaaattacttct
gtgaccaaagaatctatgacactttgctggtcaagacccgagagtgatggaggtagtgaa
atatctggatatataattgaaaggcgagagaaaaatagcctaagatgggtgcgtgtaaac
aaaaaaccagtttatgatctaagagtgaaatcaacaggacttcgggaaggatgtgaatat
gaatatcgtgtttatgcagaaaatgctgctggcctaagtcttccaagtgaaacctctccc
ttaattagggcagaagatccagtgttcctaccatctcctccatccaaacccaaaattgtg
gactcaggcaagacaactataactattgcctgggttaagccgctgtttgatggtggggcc
ccgataactggatatactgtagaatacaaaaaatctgatgacactgactggaaaacttcc
attcagagcttacgagggacagaatatacaataagcggactaacaacaggagctgaatat
gttttcagagtaaaatctgtcaataaggttggtgctagtgaccccagtgatagctctgac
cctcagatagcaaaggaaagagaagaagaacctttatttgatattgacagtgaaatgagg
aagaccttgattgtcaaggctggtgcctcatttaccatgactgtgcctttccgaggaaga
ccagtacccaatgtcttgtggagtaagccagacactgacctccgtactagagcttatgtt
gataccacagactctcgtacatcactgaccattgaaaatgccaacagaaatgactctgga
aagtacacattaacaattcagaatgttttgagtgctgcttcactgaccttagttgtcaaa
gttttagataccccaggtcctccaaccaacattactgtgcaagatgtaaccaaagagtct
gcagtgttatcctgggatgttcctgaaaacgatggtggagcaccagtgaagaattaccac
atagaaaaacgtgaggccagcaagaaagcatgggtctctgtgaccaacaactgtaaccgc
ctctcctacaaagttaccaatttacaagaaggagctatctattacttcagagtctctgga
gaaaatgagtttggtgttggtataccagctgaaacaaaggaaggagtaaaaataacagaa
aaaccaagcccacctgaaaaacttggagtaacaagtatatccaaagacagtgtttccctg
acctggctgaagcctgaacatgatggcggaagcagaattgtacactatgtcgttgaagca
ctagaaaaaggacagaaaaactgggttaaatgtgcagtggcaaagtcaacccatcacgtt
gtttccggtctgagagagaattctgaatactttttccgagtgtttgctgaaaatcaagct
ggcctgagtgacccgagagagcttctgcttcctgttcttattaaggagcaactagaacca
cctgaaattgatatgaagaatttcccaagtcacactgtatatgttagagctggttcaaac
cttaaagttgacattccaatctctggaaaaccacttcccaaagtgaccttatcaagagat
ggtgtcccccttaaggcaaccatgagatttaataccgaaattactgctgagaacctgacc
atcaatctcaaagaaagtgttacagctgacgctgggagatatgaaatcactgctgccaac
tccagtggtacaaccaaagctttcattaacattgttgtgctagacaggcctggtcctcca
actggccctgttgttattagtgatataactgaagaaagtgtgactctcaaatgggagcca
cctaagtatgacggtggaagtcaagttaccaactacattctactcaaaagagaaacaagt
actgcagtgtggactgaagtgtctgcaacagttgcaagaaccatgatgaaagtcatgaaa
ctgaccacaggagaagaataccaattccgcatcaaggcagaaaaccgctttggcatcagt
gatcatatagattcagcttgtgtgactgtcaaactaccatacacaacacctggaccacca
tctacaccatgggtcactaatgttactcgagaaagcatcactgtgggctggcatgaacca
gtgtcaaatggaggcagtgcagtcgtaggctatcacctggaaatgaaagacagaaacagt
attttatggcaaaaagccaacaaactggtcatccgcacaactcacttcaaagtcacaaca
atcagtgctggacttatttatgaattcagggtgtatgcagaaaatgctgctggagttgga
aaacctagccatccttctgaaccagtcttggcaattgatgcttgtgaacccccaagaaat
gttcgtatcactgatatttcaaagaactctgtcagcctttcatggcaacaaccagctttc
gatggaggtagcaagattacaggctacattgttgagagacgtgaccttccagatggcaga
tggaccaaggccagcttcaccaatgttactgaaactcaattcatcatctctggcttgact
cagaattcccagtatgaattccgtgtctttgctaggaatgctgttggttccattagcaat
ccatctgaggttgtagggcccattacttgcatcgattcttatggtggtcctgtaattgat
ttgcctctagaatatacagaagttgtcaaatacagagcaggtacatctgtgaagctcaga
gctggcatttctggcaaacctgcgcctactattgagtggtataaagatgataaagaatta
caaaccaatgcactggtgtgtgttgaaaataccacggacctcgcatctatactcatcaaa
gatgccgatcgccttaatagtggatgctatgaattaaaactaaggaatgccatgggctca
gcctcagccaccatcagagtacagatccttgacaaaccaggcccacctggtggaccaatt
gaatttaagactgtaactgctgagaagatcacccttctctggcggcctccagctgatgat
ggtggtgcaaaaatcactcactacattgtggaaaagcgtgagacaagccgcgttgtgtgg
tctatggtgtctgaacatttggaagagtgcatcattacaaccaccaaaattatcaaagga
aatgaatacatcttccgggtccgagccgtgaacaaatatggaattggcgagccactggaa
tctgattccgttgtagccaagaacgcatttgttacacctgggccaccaggcataccagaa
gtgacaaagattaccaagaattcgatgactgttgtatggagcaggccaattgcagatggc
ggtagtgatataagtggctatttccttgaaaaacgagacaagaagagcctaggatggttt
aaagtactaaaagagactatccgtgacaccagacaaaaagtaacaggactcacagaaaac
agtgactatcaatacagagtttgtgctgtaaacgctgctggacagggtccattttctgaa
ccatctgaattctacaaagctgctgatcctattgatcctccaggtccacctgctaagata
agaatcgcagattcaaccaagtcatccatcacccttggctggagtaagcctgtctatgat
gggggcagtgctgttactgggtatgttgtcgagataagacaaggagaggaagaggaatgg
actactgtctctaccaaaggagaggtcagaactacagaatatgtggtatccaacctgaaa
cctggagtcaattactacttccgggtatctgctgtaaactgtgctggacaaggagaacct
atagaaatgaatgaacctgtacaagctaaagatatacttgaggcaccagagattgacctg
gatgtggctctcagaacttctgttattgccaaagctggtgaagatgtacaagtgttgatt
ccctttaaaggcagacctccacctactgtcacatggagaaaagatgagaagaatcttggc
agtgatgccagatacagcattgaaaacactgattcatcctcattactcaccattcctcaa
gttactcgcaatgatacaggaaaatatattctcacaatagaaaatggagttggtgaacct
aagtcttcaactgtgagtgttaaagtgcttgacacaccagctgcctgccagaaactacag
gttaaacatgtttctcgaggcacagtcactttgctctgggatcctcctctcattgatgga
ggatctccaataattaattatgtcattgaaaagagagatgccaccaagagaacatggtct
gtcgtgtcacacaaatgttctagcacatccttcaagctaatagatttgtcggagaagact
ccattcttcttcagagttcttgcagaaaatgaaattggaattggggaaccctgtgaaact
acagagccagtgaaggctgctgaagtaccagctcctatacgtgatctctcaatgaaagac
tcaacaaagacatctgtcatcctcagctggaccaaacctgactttgatggtggtagcgtc
atcacagaatatgttgtagaaaggaaaggtaaaggtgaacagacgtggtcccacgctggc
ataagtaagacatgtgaaattgaggttagccaacttaaggagcagtcagtcctggagttc
agagtgtttgccaaaaatgagaaaggactgagtgatcctgtcactattgggccaattaca
gtgaaagaacttattattacacctgaagttgacctgtcagatatccctggggcacaagtc
actgtgagaattgggcacaatgtgcaccttgaattaccttataagggaaaacccaaacca
tccatcagttggctgaaagatggcttgccactgaaagaaagtgaatttgttcgcttcagt
aaaactgaaaacaaaattactttgagtattaagaatgccaagaaggagcatggaggaaaa
tacactgttattcttgataatgcagtgtgtagaattgcagtccccattacagtcatcacc
cttggcccaccatcaaagcccaaaggacccattcgatttgatgaaatcaaggctgatagt
gtcatcctgtcatgggatgtacctgaagataatggaggaggagaaattacttgttacagc
atcgagaagcgggaaacttcacaaactaactggaagatggtgtgttcaagtgttgccaga
acgactttcaaagttcctaatctagtcaaagatgctgagtaccagtttagagtgagagca
gaaaacagatacggagtcagccaaccacttgtctcaagcattattgtggcaaaacaccag
ttcaggattcctggtcccccaggaaagccagttatatacaatgtgacttctgatggcatg
tcactaacttgggatgctccagtttatgatggtggttcagaagttactggattccatgtt
gaaaagaaagaaagaaatagcatcctctggcaaaaagttaatacatcaccaatctctgga
agagaatatagagccactggactggtagaaggtctggattaccaattccgtgtatatgct
gaaaattctgctggcctaagctcacctagtgacccaagcaaatttaccttagctgtttct
ccagtagacccacctggcactcctgactacattgatgtcacccgggaaaccatcacactt
aaatggaacccaccattgcgtgatggaggcagtaagattgtgggctatagcattgagaaa
cggcaaggaaatgaacgctgggtgagatgcaactttactgacgtcagtgaatgtcagtac
acagttacaggactcagtcctggggatcgctatgagttcagaataattgcaagaaatgct
gttggaactataagcccgccctcacagtcttctggcattattatgacaagagatgaaaat
gttccaccaatagtagagtttggccctgaatactttgatggtctcattattaagtccgga
gagagccttagaattaaagctttggtacaaggaagaccagtgcctcgagtaacttggttc
aaagatggagtggaaatcgaaaagaggatgaatatggaaataaccgacgtacttggatcc
accagcctatttgttagagatgctactcgggaccatcgtggtgtatacacagtggaagcc
aaaaatgcatctggttctgcaaaagcagaaattaaagtgaaagtacaagatacaccagga
aaagtagttgggccaataagattcaccaatattactggggagaagatgactctgtggtgg
gatgccccactcaatgacggttgtgctcccataacccactacatcattgaaaaacgggaa
accagcagacttgcctgggcactaattgaggataaatgtgaagcccaaagttacactgcc
attaaactaataaacggcaatgaataccaattccgtgtttctgcagttaacaagtttggt
gttggcaggccacttgattctgatccagtggttgctcaaatacaatatactgttcctgat
gcccctggcattccagaacctagcaacataacaggcaacagcattaccctgacatgggca
aggccagaatcagatggtggcagtgaaattcaacagtatatccttgaaagaagagaaaag
aaaagcacaagatgggtaaaagtgatcagcaaacgaccaatctctgaaacaagattcaaa
gtcactggtctgacagaaggcaatgagtatgaattccatgtcatggctgaaaatgctgca
ggagttggacctgcaagtggcatctcaagactcattaaatgtagagagcccgtcaaccca
ccaggtcctcccacagtggtcaaagtaacagacacatcaaagacaactgtgagcttagaa
tggtccaaaccagtgtttgatggtggcatggaaataattgggtatattattgaaatgtgt
aaggccgacttaggagactggcacaaggtgaatgcagaggcatgtgtgaaaacaagatat
acagtcactgatctacaagcaggtgaagaatacaaattccgagttagtgctatcaatggt
gctggaaaaggcgacagctgtgaagtgactggcacaattaaagcagttgaccggttaaca
gctcctgagttagacatagatgcaaacttcaaacagactcatgttgttagagctggggcc
agtattcgcctcttcattgcctaccaaggtagacctactcctacagctgtgtggagcaaa
ccagactctaaccttagccttcgggctgatatccatacaacagattccttcagcaccctc
actgtggaaaactgcaacagaaatgatgcagggaaatatacccttactgtggaaaacaac
agtggtagtaagtcaatcacattcaccgtgaaagtgctagacactccaggcccacctggc
ccaattaccttcaaagatgtgacccggggatctgctacattgatgtgggatgcccctctt
cttgacggtggtgcccgaatccatcattatgtggtagagaaacgagaggcaagtcgccgt
agttggcaggttatcagtgaaaaatgcactcgtcagatcttcaaggtcaatgacctggcc
gaaggtgttccgtactatttccgtgtttctgcagtaaatgagtatggtgttggtgagccc
tatgaaatgccagaaccaattgtagccacagaacagcctgctccacctaggagacttgat
gttgttgatactagcaaatcctccgcagtcttagcttggcttaaacctgaccacgatgga
ggcagccggatcactggctacctgcttgaaatgagacaaaagggatctgacttctgggtt
gaagctggtcacaccaaacagctaactttcacagtagagcgtcttgttgagaaaactgaa
tatgaattccgtgtgaaggccaagaatgatgctggctatagtgaacccagagaagccttc
tcttctgtcatcattaaggagcctcaaatcgagcccactgctgacctcactggaattacc
aatcagcttataacttgcaaagcaggaagcccatttaccattgacgtaccaatcagtggt
cgtcctgcccccaaagtaacatggaaactggaagaaatgagacttaaagagacagatcga
gtgagcattacaacaacaaaagacagaaccacactgactgtaaaggacagcatgagaggt
gactctggaagatacttcttgaccctggaaaatacagctggtgttaaaacatttagcgtc
acagttgtggtcattggaaggccaggtccagtaaccggccccattgaggtctcatctgtc
tcagctgaatcgtgtgtcctgtcatggggagaacctaaagatggaggaggcactgaaatt
actaattacatagttgaaaagcgtgaatcgggtacaacagcttggcagcttgtcaattcc
agtgtcaagcgcactcaaattaaagtcactcatctcacaaaatacatggaatattctttc
cgtgtcagttcagagaacagatttggtgtcagcaaacctctagaatcagcaccaataatt
gctgaacatccatttgtcccaccaagcgctcctaccagacctgaggtctaccatgtgtct
gccaatgccatgtctattcgttgggaagaaccctaccacgatggtggcagtaaaatcatt
ggctactgggttgagaagaaagaacgtaatacaattctttgggtgaaagaaaacaaagtg
ccatgcttagagtgcaactacaaagtaactggtttagtagaaggactggaatatcagttc
agaacttatgcactcaatgctgcaggtgttagcaaggccagcgaagcttcaagacctata
atggctcaaaatccagttgatgcaccaggcagaccagaggtgacagatgtcacaagatca
acagtatcactgatttggtctgccccagcgtatgatggaggcagcaaggttgtgggctac
atcatagagcgtaagccagtcagtgaggtaggagatggtcgctggctgaagtgcaactac
accattgtatctgacaatttcttcaccgtgactgctctcagtgaaggagacacttatgag
ttccgtgtgttagccaagaatgcagcaggcgtaattagcaaagggtctgaatctacaggc
cctgtcacttgccgagatgaatacgctccacccaaagccgaactggatgcccgattacac
ggtgatctggttaccatcagagcaggttctgatcttgttctggatgctgcagttggtggc
aaacctgaacccaaaattatctggaccaaaggagacaaggagctagatctctgtgaaaaa
gtctctttgcagtatactggcaaacgagcaactgctgtgatcaagttctgtgacagaagt
gacagtggaaaatacactttaacagtgaaaaatgccagcgggaccaaggccgtgtctgtc
atggtcaaagtgcttgattcccctggcccatgtggaaagctcaccgtcagcagagtaaca
caggagaagtgcactttagcctggagccttccgcaggaagacggaggagcagaaatcact
cactacatcgtggaaagacgcgagactagcaggctcaactgggtgattgttgaaggcgaa
tgcccaaccctatcctatgtcgttaccaggctcatcaagaacaatgagtacatattccga
gtgagggcagtaaacaaatatggccctggtgtgcctgttgaatcagagccaattgtagcc
agaaactcattcactattccatcaccacccggcatacctgaagaagttgggactggcaaa
gagcatatcatcattcagtggacaaaacctgaatctgatggtggcaatgaaatcagcaac
tacctagtagacaaacgtgagaagaagagcctgcgctggacacgtgtcaacaaagactat
gtggtgtatgataccaggctgaaggtgaccagcctgatggagggttgtgattaccagttc
cgggtgaccgcagtgaatgcagctggtaacagtgagcccagcgaagcttccaacttcatc
tcatgcagagaaccatcatatacccctggaccaccttctgctccaagagttgtggatacc
accaaacacagcattagtttggcatggaccaaacccatgtacgatggtggtactgacatt
gtaggatatgttctggaaatgcaagagaaggacactgatcagtggtaccgagtgcatacc
aatgccacaataagaaatactgaattcactgtgccagaccttaaaatgggccagaaatat
tccttcagagttgctgccgtgaacgtgaagggtatgagcgaatacagcgaatcaattgct
gaaattgagcccgtggaaagaatagaaataccagatcttgagcttgcagatgatctaaag
aagactgtgaccatcagggctggggcctccttgcgcttgatggtgtctgtatctggaaga
ccacctcctgtcataacgtggagcaagcagggcattgaccttgcaagccgggcaattatt
gacaccactgagagctactcattgctaatagtggacaaagttaatcggtacgatgctgga
aaatacacaattgaagctgaaaaccaatctggcaagaaatcagcaacagtccttgttaaa
gtctatgatactcctggtccctgtccttcagtgaaagttaaggaagtatcaagagattct
gtgactataacttgggaaattcccacgattgatggtggagctccagtcaacaattacatc
gttgagaagcgtgaagctgctatgagagcattcaaaacagtaactaccaaatgcagcaag
acactttacagaatttctggacttgtagaaggaaccatgtactatttcagagtgctgcca
gaaaatatttatggcattggagaaccttgtgaaacatctgatgcagtactggtctcagaa
gtgcctttggtgcctgcaaagctagaagtggtcgatgtcaccaaatccactgttaccctt
gcctgggaaaaaccactctacgatggtggtagccgactcactggatatgttctcgaggcc
tgcaaagctggcacagagagatggatgaaggttgtcaccttaaaacccacagtcctagag
cacactgttacttccttaaatgaaggtgaacaatacttatttagaataagggcacaaaat
gagaaaggtgtgtcagaaccaagagagactgtcacagccgtgactgtacaagacctcaga
gtgttgccaacaatcgatctttctacaatgcctcagaagaccatccatgtcccagctggc
agaccagtagagctggtgatacctattgctggccgtccacctcctgctgcttcctggttc
tttgctggttctaaactgagagaatcagagcgtgtcacagttgaaactcacactaaagta
gctaaattaaccatccgtgaaaccactatcagagatactggagaatacacacttgaattg
aagaatgttaccggaactacttcagaaaccattaaagttatcattcttgacaagcctggt
ccaccaacaggacctattaagattgatgaaattgatgctacatcaattaccatttcctgg
gaaccacctgaattggacggtggtgctccactgagtggttatgtggtagaacaacgtgac
gctcatcgtccaggatggctgcccgtttctgaatcagtgactaggtccacgtttaagttt
accagactcaccgaaggaaatgagtatgtgttccgtgtggctgcaacaaaccgcttcggg
attggctcttacttgcagtctgaggtcatagagtgtcgcagcagcatccgtattcctgga
cccccagaaacattacagatatttgatgtttcccgtgatggcatgacacttacttggtac
ccaccagaggatgacggtggctcccaagtgactggatatattgtggagcgcaaagaagtg
agagcagatcgatgggtccgtgtaaataaagtacctgtgacaatgacacggtaccgctcc
actggccttactgaaggcttagaatatgaacaccgtgtcacagccattaatgcaagaggg
tctgggaaaccaagtcgtccttccaaacccatcgttgccatggatccaattgctcctcca
ggaaagccacaaaacccaagagttactgatacaacaaggacatcagtctccctggcctgg
agtgttccagaagatgaaggaggatctaaagtcacaggctacttgattgaaatgcaaaaa
gtagatcaacatgaatggaccaagtgtaacaccactccaaccaagattcgagagtatact
ctaacacacctacctcagggtgcagaatacaggttccgcgtcctagcttgtaatgctggt
ggacctggtgagcctgctgaggtaccaggaacagtcaaagtcactgaaatgcttgaatat
cctgattatgaacttgatgaaagataccaagaaggtatctttgtaaggcaaggtggcgtc
atcagacttaccataccaatcaaaggaaaaccattcccaatatgtaaatggaccaaggaa
ggccaggatattagtaagcgtgccatgattgcaacatctgaaacacacactgagcttgtg
atcaaagaagcagacaggggtgattctggcacttatgacctggttctggaaaataaatgt
ggcaagaaggctgtctacatcaaggtcagggtgataggaagtcccaacagtccagaaggg
ccactggaatatgatgacatccaagtccgctctgtgagggtcagctggagacctcctgct
gatgatggtggtgctgacatcttaggctacatcctcgagagacgagaagtgcctaaagcc
gcctggtataccattgattccagagtccgaggtacatctctggtggtaaaaggcctcaaa
gagaatgtagaataccatttccgtgtttcagcagaaaaccagtttggcataagcaaaccc
ttgaaatctgaggaaccagtcacaccaaaaacaccattgaatcctccagaacctccaagc
aatcctccagaagtactcgatgtaaccaagagttctgttagcttgtcctggtcccggccc
aaagatgatggtggttctagagtcacaggctactacatcgaacgcaaagagacatccact
gacaagtgggtcagacacaacaagactcagatcaccaccacaatgtacactgtcacaggg
cttgttcccgatgctgagtatcagttccgcatcatcgcacagaatgatgttggcctgagt
gagaccagccctgcttctgaaccagttgtttgcaaagatccatttgataaaccaagccaa
ccaggagaacttgagattctttcaatatccaaagatagtgtcactctacagtgggagaaa
cctgaatgtgatggtggtaaagaaattcttggatactgggttgaatatagacagtctgga
gacagtgcctggaagaagagcaataaggaacgtattaaggacaagcaattcacaatagga
ggtttgctggaagctactgagtatgaattcagggtttttgctgagaatgagactgggctg
agcagacctcgcagaactgctatgtctataaagactaaactcacatctggagaggcccca
ggaatacgcaaagaaatgaaggatgttaccacaaaattgggtgaagctgctcaactctca
tgccagattgttggaaggcctcttcctgacattaaatggtacagatttggtaaagagctc
atacaaagccggaaatacaaaatgtcttcagatggacgcacacacactcttacagtaatg
acagaggaacaggaagatgaaggtgtttatacctgcatagccaccaatgaggttggagaa
gtagaaaccagtagtaagcttctcctgcaagcaacaccgcagttccatcctggttaccca
ctgaaagagaaatattatggagctgtgggttccacacttcggcttcatgttatgtacatt
ggtcgtccagtacctgccatgacttggttccatggtcagaaacttttgcaaaactcagaa
aacattactattgaaaacactgagcactatactcatcttgtcatgaagaatgtccaacgt
aagactcatgctgggaaatacaaagtccagctcagcaatgtttttggaacagttgatgcc
atccttgatgtggaaatacaagataaaccagacaaacctacaggaccaattgtgatcgaa
gctctattgaagaactccgcagtgatcagctggaaaccacccgcagatgacggaggctcc
tggatcaccaactatgtggtggaaaaatgtgaggccaaggagggggctgaatggcaattg
gtgtcttcagccatctcagtgacaacctgtagaattgtgaacctcacagaaaatgctggc
tattacttccgggtttcagctcagaacactttcggcatcagtgaccctctagaagtgtcc
tcagttgtgatcattaagagtccatttgaaaagccaggtgctcctggcaaaccaactatt
actgctgtcacaaaagattcttgtgttgtggcctggaagccacctgccagtgatggaggt
gcaaagattagaaattactaccttgagaagcgtgagaagaagcagaataaatggatttct
gtgacaacagaagaaattcgagaaactgtcttttcagtgaaaaaccttattgaaggtctt
gaatacgagtttcgtgtgaaatgtgaaaatctaggtggggaaagtgaatggagtgaaata
tcagaacccatcactcccaaatctgatgtcccaattcaggcaccacactttaaagaggaa
ctgagaaatctaaatgtcagatatcagagcaatgctaccttggtctgcaaagtgactggt
catccaaaacctatcgtcaaatggtacagacaaggcaaagaaatcattgcagatggatta
aaatataggattcaagaatttaagggtggctaccaccagctcatcattgcaagtgtcaca
gatgatgatgccacagtttaccaagtcagagctaccaaccaagggggatctgtgtctggc
actgcctccttggaagtggaagttccagctaagatacacttacctaaaactcttgaaggc
atgggagcagttcatgctctccgaggtgaagtggtcagcatcaagattcctttcagtggc
aaaccagatcctgtgatcacctggcagaaaggacaagatctcattgacaataatggccac
taccaagttattgtcacaagatccttcacatcacttgttttccccaatggggtagagaga
aaagatgctggtttctatgtggtctgtgctaaaaacagatttggaattgatcagaagaca
gttgaactggatgtggctgatgttcctgacccacccagaggagtcaaagttagtgatgtc
tcacgagattctgtcaacttaacatggactgagccagcctctgatggtggcagcaaaatc
accaactacattgttgaaaaatgtgcaactactgcagaaagatggctccgtgtaggacag
gcccgagaaacacgttataccgtgatcaacttatttggaaaaacaagttaccagttccgg
gtaatagctgaaaataaatttggtctgagcaagccttcagagccttcagaaccaaccata
accaaagaagataagaccagagctatgaactatgatgaagaggtagatgaaaccagggaa
gtctccatgactaaagcatctcactcttcaaccaaggaactctatgagaaatatatgatt
gctgaagatcttgggcgtggtgagtttggaattgtccatcgttgtgttgaaacatcctca
aagaagacatacatggccaaatttgttaaagtcaaagggactgatcaggttttggtaaag
aaggaaatttccattctgaatattgctaggcatagaaacatcttacacctccatgaatca
tttgaaagcatggaagaattagttatgatctttgagtttatatcaggacttgacatattt
gagcgcattaacacaagtgcttttgaacttaatgaaagagaaattgtaagttatgttcac
caggtctgtgaagcacttcagtttttacacagtcataatattggacactttgacattaga
ccagaaaatatcatttaccaaaccagaagaagctctaccattaaaatcatagaatttggt
caagcccgtcagctgaaaccaggggacaacttcaggcttctattcactgccccagaatac
tatgcacctgaagtccaccagcatgatgttgtcagcacagccacagacatgtggtcactt
ggaacactggtatatgtgctattgagtggtatcaacccattcctggctgaaactaaccaa
cagatcattgagaatatcatgaatgctgaatatactttcgatgaggaagcattcaaagag
attagcattgaagccatggattttgttgaccggttgttagtgaaagagaggaaatctcgc
atgacagcatcggaggctctccagcacccatggttgaagcagaagatagaaagagtcagt
actaaagttatcagaacattaaaacaccggcgttattaccacaccctgatcaagaaagac
ctcaacatggttgtgtcagcagcccggatctcctgtggtggtgcaattcgatctcagaag
ggagtgagtgttgctaaagttaaagtggcatccattgaaattggcccagtttctgggcag
ataatgcatgcagttggtgaagaaggaggacatgtcaaatatgtatgcaaaattgaaaat
tatgatcagtctacccaagtgacttggtactttggcgtccgacagctggagaacagtgag
aaatacgaaatcacctacgaagatggagtggccatcctctatgtcaaagacattaccaaa
ttagatgatggtacctacagatgcaaagtagtcaatgactatggtgaagacagttcttat
gcagagctatttgttaaaggtgtgagagaagtctatgactattactgccgtagaaccatg
aagaaaattaagcgcagaacagacacaatgagactcctggaaaggccaccagaatttacc
ctgcctctctataataagacagcttatgtaggtgaaaatgtccggtttggagtaactata
actgtccacccagagcctcatgtaacatggtataaatcaggtcagaaaatcaaaccaggt
gacaatgacaagaagtacacatttgagtcagacaagggtctttaccaattaacaatcaac
agtgtcactacagatgatgacgctgaatatactgttgtggcaaggaacaaatatggtgaa
gacagctgtaaagcaaagctgacagtaaccctacacccacctccaacagatagtacctta
agacccatgttcaaaaggttactggcaaatgcagaatgccaagaaggccaaagtgtctgc
tttgagatcagagtgtctggcatccccccaccaacattaaaatgggagaaagatggtcag
ccactgtccctcgggcctaacattgaaattatccatgaaggcttggattattatgctctg
cacatcagggacactttgcctgaagacacgggttattatagagtcacagccactaacaca
gctgggtccaccagctgccaggctcacctacaagtggaacgcctgaggtacaagaaacag
gaattcaagagtaaggaggagcatgagcgacacgtacaaaaacaaattgacaaaaccctc
agaatggctgaaattctttctggaactgaaagtgtaccactgacacaggtagctaaagag
gctctgagagaagctgctgtcctttataaaccggctgtaagcaccaagactgtaaaaggg
gaattcagacttgagatagaagaaaagaaggaggagagaaaactccggatgccttatgat
gtaccagagccacgcaagtataagcagactaccatagaagaagaccaacgcatcaagcag
ttcgtgcccatgtctgacatgaagtggtataaaaagatacgtgatcagtatgaaatgcct
gggaaacttgacagagttgtacagaaacgacccaagcgcatccgcctttcaagatgggaa
cagttctatgtgatgcctcttccacgcattacagatcaatacagacctaaatggcgtatt
cctaaactgtcccaagatgatcttgagatagtgagaccagcccgccggcgtacaccttct
cctgattatgacttttactaccgacctagaagacgttctcttggggacatctctgatgaa
gaattactcctccccattgatgactacttagcaatgaaaagaacagaggaagagaggctg
cgtcttgaagaagagcttgagttaggtttttcagcttcacccccaagtcgaagccctcca
cactttgagctttctagcctacgttactcttcaccacaagctcatgtcaaggtggaggaa
acaagaaaagacttcaggtattcaacctatcacatcccaacgaaggctgaagctagtaca
agttatgcagaactgagggaacggcatgcccaggctgcgtacagacagccaaagcaacgg
caaagaatcatggctgagagggaggatgaagagttgcttcgcccagttacgaccacccag
catctctcagaatacaaaagcgaacttgacttcatgtcaaaggaggaaaagtctagaaag
aaatcaaggcgacaaagagaagtgacagaaataacagaaattgaggaagaatacgaaatc
tcaaaacatgctcaaagagaatcatcctcatctgcgtctagactactgagacgacggcgc
tccctgtctccaacttatattgagttaatgaggccagtgtctgagctgatccggtcacgt
ccacaaccggctgaggaatacgaagatgacacagaaagaaggtcacctactccagagaga
actcgcccacgatcccccagccctgtgtctagtgagagatcactctcgagatttgagagg
tctgcaagatttgatatcttttccaggtatgagtccatgaaagctgctttaaaaactcag
aagacatcagaaaggaagtatgaagttttgagtcagcagcctttcacactggaccatgcc
cctcgaatcacactgagaatgcgctcgcacagggtaccatgtggccaaaatacacgtttt
attttaaatgttcagtctaagccaactgccgaggttaaatggtaccacaatggtgtggaa
ctccaagaaagcagtaagattcattacaccaacacgagtggagtcctcaccctggaaatt
ctggactgtcatactgatgacagtggaacctaccgtgctgtgtgcaccaactacaagggc
gaagcttctgactatgcaacgttggacgtgacaggaggggattataccacctatgcttcc
caacgcagagatgaagaggtccccagatctgttttccctgagctgacaagaacagaggcg
tatgctgtttcatcatttaagaaaacatctgagatggaagcttcgtcttctgtcagggaa
gtgaaatcacagatgacggagacaagggaaagtctctcctcatatgaacactctgcatct
gcagaaatgaaaagtgctgcattagaagaaaagtcactggaagaaaaatccacaaccaga
aagatcaagacgactttggcagcaagaattctaacaaagccacggtccatgaccgtctac
gagggcgagtctgcaaggttttcttgtgacaccgatggtgagccggtaccaactgtgacc
tggctgcgtaaaggacaagtgctaagtacttctgcccgccaccaagtgaccaccacaaag
tacaaatcaacctttgagatctcttcagtccaggcttccgatgagggcaattacagcgtg
gtggtagaaaacagtgaagggaaacaagaagcagagttcactctgactattcaaaaggcc
agggtaactgaaaaggctgtgacatcaccaccaagagtcaaatccccagagcctcgggtg
aaatccccagaagcagttaagtctccaaaacgagtgaaatctccagaaccttctcacccg
aaagccgtatcacccacagagacaaaaccaacaccaacagagaaagttcagcacctccca
gtctctgccccaccaaagattactcagttcctgaaagcagaagcttctaaagagattgca
aaactgacctgtgtggttgaaagcagtgtattaagggcaaaagaggtcacctggtataaa
gatggcaagaaactgaaggaaaatgggcatttccagtttcattattcagcagatggtacc
tatgagctcaaaatcaataacctcactgaatctgatcaaggagaatatgtttgtgagatt
tctggtgaaggtggaacgtctaaaaccaacttacaatttatggggcaagcctttaagagt
atccatgagaaggtatcaaaaatatcagaaactaagaaatcagatcagaaaaccactgag
tcaacagtaaccagaaaaactgaaccaaaagctcctgaaccaatttcctcaaaaccagta
attgttactgggttgcaggatacaactgtttcttcagacagtgttgctaaatttgcagtt
aaggctactggagaaccccggccaactgccatctggacaaaagatggaaaggccattaca
caaggaggtaaatataaactctctgaagacaagggagggttcttcttagaaattcataag
actgatacttctgacagtggactttatacttgtacagtaaaaaattcagctggatctgtg
tcctctagctgcaaattaacaataaaagctataaaagatactgaggcacagaaagtctct
acacaaaagacttctgaaattacacctcagaagaaagctgttgtccaagaggaaatttcc
caaaaagccctaaggtctgaagaaattaagatgtcagaggcaaaatctcaagaaaagtta
gccctcaaagaggaagcttcaaaggttctgatttctgaagaagtcaagaaatcagcagca
acctccctggaaaaatccattgtccatgaggaaatcactaaaacatcacaggcatcagaa
gaagtcagaactcatgctgagattaaagcattttctactcagatgagcataaacgaaggt
caaagactggttttaaaagccaacattgctggtgccactgatgtgaaatgggtactgaat
ggcgtagagcttaccaactctgaggagtaccgatatggtgtctcaggcagcgatcagacc
ctaaccatcaagcaagccagtcacagagatgaaggaatcctcacctgcataagcaaaacc
aaggaaggaatcgtcaagtgtcagtatgatttgacactgagcaaagaactctcagatgct
ccagccttcatctcacagcctagatctcaaaatattaatgaaggacaaaatgttctcttt
acttgtgaaatcagtggcgagccatcccctgaaatcgaatggtttaaaaacaacctgcca
atttctatttcttcaaatgtcagcataagccgctccagaaatgtatactcccttgaaatc
cgaaatgcatcagtcagcgacagtggaaagtacacaattaaggccaaaaatttccgtggc
cagtgttcagctacagcttccttaatggtccttcctctagttgaagaaccttccagagag
gtagtattgagaacaagtggtgacacaagcttgcaaggaagcttctcgtctcagtcagtc
caaatgtctgcctccaagcaggaggcctccttcagcagtttcagcagcagcagtgctagc
agcatgactgagatgaaatttgcaagcatgtctgcccaaagcatgtcctccatgcaagag
tcctttgtagaaatgagttccagcagctttatgggaatatctaatatgacacaactggaa
agctcaactagtaaaatgcttaaagcaggcataagaggaattccgcctaaaattgaagct
cttccatctgatatcagcattgatgaaggcaaagttctaacagtagcctgtgctttcacg
ggtgagcctaccccagaagtaacatggtcctgtggtggaagaaaaatccacagtcaagaa
caggggaggttccacattgaaaacacagatgacctgacaaccctgatcatcatggacgta
cagaaacaagatggtggactttataccctgagtttagggaatgaatttggatctgactct
gccactgtgaatatacatattcgatccatttaa

DBGET integrated database retrieval system