KEGG   Homo sapiens (human): 7274Help
Entry
7274              CDS       T01001                                 

Gene name
TTPA, ATTP, AVED, TTP1, alphaTTP
Definition
tocopherol (alpha) transfer protein
Organism
hsa  Homo sapiens (human)
Disease
H00981  
Ataxia with isolated vitamin E deficiency (AVED)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q12.3
AA seq 278 aa AA seqDB search
MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARD
FDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIA
HWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIA
AVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDI
LPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcgcgatcccagccctcggcggggccgcagctcaacgcgctaccggaccac
tctccgttgctgcagccgggcctggcggcgctgcggcgccgggcccgggaagctggcgtc
ccgctcgcgccgctgccgctcaccgactccttcctgctgcggttcctgcgcgcccgggat
ttcgatctggacctggcctggcggttactaaaaaactattataagtggagagcagaatgt
ccagaaataagtgcagatctacaccctagaagtattattggcctcctaaaggctggctac
catggagtcctgagatccagggatcccactggcagcaaagttcttatttacagaatcgca
cactgggaccccaaagtttttacagcttatgacgtatttcgagtaagtctaatcacatcc
gagcttattgtacaggaggtagaaactcagcggaatggaatcaaggctatctttgatctg
gaaggttggcagttttctcatgcttttcaaatcactccatccgtagccaagaagattgct
gctgtacttacggattcatttccattgaaagttcgtggcatccatttgataaatgaacca
gtaattttccatgctgtcttttccatgatcaaaccattcctgactgaaaaaattaaggaa
cggattcacatgcatgggaacaactacaaacaaagcttgcttcagcatttcccagacatt
cttcctctggaatatggtggtgaagaattctccatggaggacatttgtcaggaatggaca
aattttataatgaagtctgaagattatctcagcagcatttctgagagcattcaatga

DBGET integrated database retrieval system