KEGG   Homo sapiens (human): 727897Help
Entry
727897            CDS       T01001                                 

Gene name
MUC5B, MG1, MUC-5B, MUC5, MUC9
Definition
mucin 5B, oligomeric mucus/gel-forming
Orthology
K13908  
mucin-5B
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Disease
H01299  
Idiopathic pulmonary fibrosis
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 5762 aa AA seqDB search
MGAPSACRTLVLALAAMLVVPQAETQGPVEPSWENAGHTMDGGAPTSSPTRRVSFVPPVT
VFPSLSPLNPAHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRR
GLVGSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLV
LTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGP
TEQCPDPLPLPAGNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCPTCPCA
TFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCV
DGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLP
CPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTDNENCLKA
VTLSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQL
VPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANA
RNSFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSED
CLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADV
TCSVSFVPVDGCTCPAGTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGK
LSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPG
LVSDGSGGCIAEEDCPCVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGD
GHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVE
SYELILQEGTFKAVARGPGGDPPYKIRYMGIFLVIETHGMAVSWDRKTSVFIRLHQDYKG
RVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSW
AQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAG
LCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKC
PPSQPFFNEDQMKCVAQCGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEACT
CTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPH
STTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLADIEC
RAAQLPDMPLEELGQQVDCDRMRGLMCANSQQSPPLCHDYELRVLCCEYVPCGPSPAPGT
SPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGT
TTCQPRCQWTEWFDEDYPKSEQLGGDVESYDKIRAAGGHLCQQPKDIECQAESFPNWTLA
QVGQKVHCDVHFGLVCRNWEQEGVFKMCYNYRIRVLCCSDDHCRGRATTPPPTTELETAT
TTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLGTATTGGPTTPAGS
TEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMATSRARPTGTASTASKEP
LTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQPKCEWTEWFDVDFPT
SGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKNE
DQTGRFNMCFNYNVRVLCCDDYSHCPSTPATSSTATPSSTPGTTWILTKPTTTATTTAST
GSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTATSV
TPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTATATTTGATGSVATPS
STPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTH
TATVLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPGTTPIPP
VLTTTATTPAATSNTVTPSSALGTTHTPPVPNTMATTHGRSLPPSSPHTVRTAWTSATSG
ILGTTHITEPSTVTSHTLAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATS
RTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDT
YSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCF
NYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTESTGSTATPSSTPG
TTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPFSSPGTAT
ALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVL
TTTATTTGATGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTARTLPVWISTTTTP
TTRGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITAT
GSTTNPSSTPGTTPIPPVLTTTATTPAATSSTVTPSSALGTTHTPPVPNTTATTHGRSLS
PSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQHSTPALSSPHPSSRTTE
SPPSPGTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEW
LDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDF
GLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAA
TTTATTGSTAIPSSTPGTAPPPKVLTSTATTPTATSSKATSSSSPRTATTLPVLTSTATK
STATSFTPIPSFTLGTTGTLPEQTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRATS
SMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTATVTVPTGST
ATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPTATSVTAI
PSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRATGSVATPSSTP
GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTHTAT
VLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPGTTPIPPVLT
TTATTPAATSSTVTPSSALGTTHTPPVPNTTATTHGRSLPPSSPHTVRTAWTSATSGILG
TTHITEPSTVTSHTPAATTSTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRGTSRTT
ATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSN
IRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYE
IRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTTESTGSTATPSSTPGTTW
ILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPFSSPGTATALP
ALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTTT
ATTTRATGSVATPSSTPGTAHTTKVPTTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTS
GSTVTPSSVPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTPPSLITTATTITATGST
TNPSSTPGTTPIPPVLTTTATTPAATSSTVTPSSALGTTHTPPVPNTTATTHGRSLSPSS
PHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPP
SPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDY
SYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLV
CRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTT
ASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSKATSSSSPRTATTLPVLTSTATKSTA
TSVTPIPSSTLGTTGTLPEQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTS
TPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATP
SSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPSSS
PGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVH
TSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWIS
TTTTPTTTTPTTSGSTVTPSSIPGTTHTARVLTTTTTTVATGSMATPSSSTQTSGTPPSL
TTTATTITATGSTTNPSSTPGTTPITPVLTSTATTPAATSSKATSSSSPRTATTLPVLTS
TATKSTATSFTPIPSSTLWTTWTVPAQTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMT
RATNSTATPSSTLGTTRILTELTTTATTTAATGSTATLSSTPGTTWILTEPSTIATVMVP
TGSTATASSTLGTAHTPKVVTTMATMPTATASTVPSSSTVGTTRTPAVLPSSLPTFSVST
VSSSVLTTLRPTGFPSSHFSTPCFCRAFGQFFSPGEVIYNKTDRAGCHFYAVCNQHCDID
RFQGACPTSPPPVSSAPLSSPSPAPGCDNAIPLRQVNETWTLENCTVARCVGDNRVVLLD
PKPVANVTCVNKHLPIKVSDPSQPCDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYV
LMREIHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLI
LFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQ
CGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTP
TPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHCRGRLEVPCQSLEAYAELCRA
RGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQIL
FNAHMGICVQACPCVGPDGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPC
NRPGFVTVTRPRAENPCCPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRP
QLCSYNGTFYGVGATFPGALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAG
QCCGECVQTACLTPDGQPVQLNETWVNSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSC
RGSLRKTGCCYSCEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQH
QCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEAT
AV
NT seq 17289 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgagcgcgtgccggacgctggtgttggctctggcggccatgctcgtggtg
ccgcaggcagagacccagggccctgtggagccgagctgggagaatgcagggcacaccatg
gatggcggtgccccgacgtcctcgcccacccggcgcgtgagctttgttccacccgtcact
gtcttccccagcctgagccccctgaacccggcgcacaatgggcgggtgtgcagcacctgg
ggtgacttccactacaagaccttcgacggcgacgtcttccgcttccctggcctttgcaac
tacgtgttctctgagcactgccgcgccgcctacgaggacttcaacgtccagctacgccga
ggcctagtgggctccaggcctgtggtcacccgtgttgtcatcaaggcccaggggctggtg
ctggaggcgtccaacggctccgtcctcatcaatgggcagcgggaggagctgccttacagc
cgcactggcctcctggtggagcagagcggggactacatcaaggtcagcatccggctggtg
ctgacattcctgtggaacggagaggacagtgccctgctggagctggatcccaaatacgcc
aaccagacctgtggcctgtgtggggacttcaacggcctcccggccttcaacgagttctat
gcccacaacgccaggctgaccccgctccagtttgggaacctgcagaagttggatgggccc
acggagcagtgcccggacccgctgcccttgccggccggcaactgcacggacgaggagggc
atctgccaccgcaccctgctggggccggcctttgcggagtgccacgcactggtggacagc
actgcgtacctggccgcctgcgcccaggacctgtgccgctgccccacctgcccgtgtgcc
acctttgtggaatactcacgccagtgcgcccacgcggggggccagccgcggaactggagg
tgccctgagctctgcccccggacctgccccctcaacatgcagcaccaggagtgtggctca
ccctgcacggacacctgctccaacccccagcgcgcgcagctctgcgaggaccactgtgtg
gacggctgcttctgccccccaggcacggtgctggatgacatcacgcactctggctgcctg
cccctcgggcagtgcccctgcacccacggcggccgcacctacagcccgggcacctccttc
aacaccacctgcagctcctgcacctgctccggggggctatggcagtgccaggacctgccg
tgccctggcacctgctctgtgcagggcggggcccacatctccacctatgatgagaaactc
tacgacctgcatggtgactgcagctacgttctgtccaagaaatgtgccgacagcagcttc
accgtgctggctgagctgcggaagtgcggcctgacggacaacgagaactgcctgaaagcg
gtgacgctcagcctggacggcggggacacggccatccgggtccaagcggacggcggcgtg
ttcctcaactccatctacacgcagctgcccctgtcggcagccaacatcaccctgttcaca
ccctcgagcttcttcatcgtggtgcagacaggcctggggctgcagctgctggtgcagctg
gtgccactcatgcaggtgtttgtcaggctggaccccgcccaccagggccagatgtgcggc
ctgtgtgggaacttcaaccagaaccaggctgacgacttcacggccctcagcggggtggtg
gaggccacgggcgcagccttcgccaacacctggaaggcccaggctgcctgtgccaatgcc
aggaacagctttgaggacccctgctccctcagtgtggagaatgagaactacgcccggcac
tggtgctcgcgcctgaccgatcccaacagtgccttctcgcgctgccactccatcatcaac
cccaagcccttccactcgaactgcatgtttgacacctgcaactgtgagcggagcgaggac
tgcctgtgcgccgcgctgtcctcctatgtgcacgcctgtgccgccaagggcgtacagctc
agcgactggagggacggcgtctgcaccaagtacatgcagaactgccccaagtcccagcgc
tacgcctacgtggtggatgcctgccagcccacttgccgcggcctgagtgaggccgacgtc
acctgcagcgtttccttcgtgcctgtggacggctgcacctgccccgcgggcaccttcctc
aatgacgcgggcgcctgtgtgcccgcccaggagtgcccctgctacgctcacggcaccgtg
ctggctcctggagaggtggtgcacgacgagggcgccgtgtgttcatgtacgggtgggaag
ctaagctgcctgggagcctctctgcagaaaagcacagggtgtgcagcccccatggtgtac
ctggactgcagcaacagctcggcgggcacccctggggccgagtgcctccggagctgccac
acgctggacgtgggctgtttcagcacacactgcgtgtccggctgtgtctgtcccccgggg
ctggtgtcggatgggagtgggggctgcattgccgaggaggactgcccctgtgtgcacaac
gaggccacctacaagcctggagagaccatcagggtcgactgcaacacctgcacctgcagg
aaccggaggtgggagtgcagccaccggctctgcctgggcacctgcgtggcctacggggat
ggccacttcatcacctttgatggcgatcgctacagctttgaaggcagctgcgagtacatc
ttggcccaggactactgtggggacaacaccacccacgggaccttccgcatcgtcaccgag
aacatcccctgtgggaccaccggcaccacctgctccaaggccatcaagctcttcgtggag
agctacgagctgatcctccaagaggggacctttaaggcggtggcgagagggccgggtggg
gacccaccctacaagatacgctacatggggatcttcctggtcatcgagacccacgggatg
gccgtgtcctgggaccggaagaccagcgtgttcatccgactgcaccaggactacaagggc
agggtctgcggcctgtgcgggaacttcgacgacaatgccatcaatgactttgccacgcgt
agccggtccgtggtgggggacgcactggagtttgggaacagctggaagctctccccctcc
tgcccggacgccctggcacccaaggacccctgcacggccaaccccttccgcaagtcctgg
gcccagaagcagtgcagcatcctccacggccccaccttcgccgcctgccgctcccaggtt
gactccaccaagtactacgaggcctgcgtgaacgacgcgtgtgcctgcgactcgggtggc
gactgcgagtgtttctgcacggctgtggctgcctacgcccaggcctgccacgacgcgggc
ctgtgtgtgtcctggcggactccggacacctgccccttgttctgtgacttctacaaccca
catgggggctgtgagtggcactaccagccctgcggggcaccctgcctaaaaacctgccgg
aaccccagtgggcactgcctggtggacctgcctggcctggaaggctgctacccgaagtgc
ccacccagccagcccttcttcaatgaggaccagatgaagtgcgtggcccagtgtggctgc
tacgacaaggacggaaactactatgacgtcggtgcaagggtccccacagcggagaactgc
cagagctgtaactgcacacccagtggcatccagtgcgctcacagccttgaggcctgcacc
tgcacctatgaggacaggacctacagctaccaggacgtcatctacaacaccaccgatggg
cttggcgcctgcttgatcgccatctgcggaagcaacggcaccatcatcaggaaggctgtg
gcatgtcctggaactccagccacaacgccattcaccttcaccaccgcctgggtcccccac
tccacgacaagcccggccctcccggtctccaccgtgtgtgtccgcgaggtctgccgctgg
tccagctggtacaatgggcaccgcccagagcccggcctgggaggcggagactttgagacg
tttgaaaacctgaggcagagagggtaccaggtatgccctgtgctggctgacatcgagtgc
cgggcggcgcagcttcccgacatgccgctggaggagctgggccagcaggtggactgtgac
cgcatgcgggggctgatgtgcgccaacagccaacagagtcccccgctctgtcacgactac
gagctgcgggttctctgctgcgaatacgtgccctgtggcccctccccggccccaggcacc
agccctcagccctccctcagtgccagcacggagcctgctgtgcctaccccaacccagacc
acagcaaccgaaaagaccaccctatgggtgaccccgagcatccggtcgacggcggccctc
acctcgcagactgggtccagctcaggccccgtgacggtcaccccctcggccccaggtacc
accacctgccagccccggtgtcagtggacagagtggtttgatgaggactaccccaagtct
gaacaacttggaggggacgttgagtcctacgataagatcagggccgctggagggcactta
tgccagcagcctaaggacatagagtgccaggccgagagcttccccaactggaccctggca
caggtggggcagaaggtgcactgtgacgtccacttcggcctggtgtgcaggaactgggag
caggagggcgtcttcaagatgtgctacaactacaggatccgggtcctctgctgcagtgac
gaccactgcaggggacgtgccacaaccccgccaccgaccacagagctggagacggccacc
accaccaccacccaggccctgttctcaacgccgcagcctacgagtagcccggggctgacc
agggctcccccggccagcaccacagcagtccccaccctctcagaaggactgacatccccc
agatacacaagcacccttggtacagccaccacgggaggccccacgacgcctgcaggctcc
acagaacccactgtcccaggggtggccacatccacccttccaacacgctcagcccttcca
gggacgacggggagcttgggcacatggcgcccctcacagccacccacgctggccccaaca
acaatggcaacctccagagctcgcccgacaggcacagccagcaccgcttccaaagagccg
ctgaccacgagcctggcgccaacactcacgagcgagctgtccacctctcaggccgagacc
agcacgcccaggacagagacgacaatgagccccttgactaacaccaccaccagccagggc
acgacccgctgtcaaccgaagtgtgagtggacagagtggtttgacgtggacttcccaacc
tcaggggttgcaggcggggacatggaaacttttgaaaacatcagggctgctgggggcaag
atgtgctgggcaccaaagagcatagagtgccgggcggagaactaccccgaggtaagcatc
gaccaggtcgggcaggtgctgacctgcagcctggagacggggctgacctgcaagaacgaa
gaccagacaggcaggttcaacatgtgcttcaactacaacgtgcgtgtgctttgctgtgac
gactacagccactgccccagtaccccagccaccagctccacggccacgccctcctcaact
ccggggacgacctggatcctcacaaagccgaccacaacagccactacgactgcgtccact
ggatccacggccaccccgacctccaccctgagaacagctccccctcccaaagtgctgacc
accacggccaccacacccacagtcaccagctccaaagccactccctcctccagtccaggg
actgcaaccgcccttccagcactgagaagcacagccaccacacccacagctaccagcgtt
acacccatcccctcttcctccctgggcaccacctggacccgcctatcacagaccaccaca
cccacggccaccatgtccacagccacaccctcctccactccagagactgcccacacctcc
acagtgcttaccgccacggccaccacaactggggccaccggctctgtggccaccccctcc
tccaccccaggaacagctcacactaccaaagtgccaactaccacaaccacgggcttcaca
gccaccccctcctccagcccagggacggcactcacgcctccagtgtggatcagcacaacc
accacacccacaaccagaggctccacggtgaccccctcctccatcccggggaccacccac
accgccacagtgctgaccaccaccaccacaactgtggccactggttctatggcaacaccc
tcctctagcacacagaccagtggtactcccccatcactgaccaccacggccactacgatc
acggccaccggctccaccaccaacccctcctcaactcctgggacaactcccatcccccca
gtgctgaccaccaccgccaccacacctgcagccaccagcaacacagtgactccctcctct
gccctagggaccacccacacacccccagtgccgaacaccatggccaccacacacgggcga
tccctgccccccagcagtccccacacggtgcgcacagcctggacttcggccacctcgggc
atcttgggcaccacccacatcacagagccttccacggtgacttcccacaccctagcagca
accaccggtaccacccagcactcgactccagccctttccagccctcaccctagcagcaga
accaccgagtcacccccttctccagggacgaccaccccgggccacaccacggccacctcc
aggaccacagccacggccacacccagcaagacccgcacctcgaccctgctgcccagcagc
cccacatcggcccccataaccacggtggtgaccatgggctgtgagccccagtgtgcctgg
tcagagtggctggactacagctaccccatgccggggccctctggcggggactttgacacc
tactccaacatccgtgcggccggaggggccgtctgtgagcagcccctgggcctcgagtgc
cgtgcccaggcccagcctggtgtccccctgcgggagttgggccaggtcgtggaatgcagc
ctggactttggcctggtctgcaggaaccgtgagcaggtggggaagttcaagatgtgcttc
aactatgaaatccgtgtgttctgctgcaactacggccactgccccagcaccccggccacc
agctctacggccatgccctcctccactccggggacgacctggatcctcacagagctgacc
acaacagccactacgactgagtccactggatccacggccaccccgtcctccaccccaggg
accacctggatcctcacagagccgagcactacagccaccgtgacggtgcccaccggatcc
acggccaccgcctcctccacccaggcaactgctggcaccccacatgtgagcaccacggcc
acgacacccacagtcaccagctccaaagccactcccttctccagtccagggactgcaacc
gcccttccagcactgagaagcacagccaccacacccacagctaccagctttacagccatc
ccctcctcctccctgggcaccacctggacccgcctatcacagaccaccacacccacggcc
accatgtccacagccacaccctcctccactccagagactgtccacacctccacagtgctt
accaccacggccaccacaaccggggccaccggctctgtggccaccccctcctccacccca
ggaacagctcacactaccaaagtgctgactaccacaaccacgggcttcacagccaccccc
tcctccagcccagggacggcacgcacgcttccagtgtggatcagcacaaccaccacaccc
acaaccagaggttccacggtgaccccctcctccatcccggggaccacccacacccccaca
gtgctgaccaccaccaccacaactgtggccactggttctatggcaacaccctcctctagc
acacagaccagtggtactcccccatcactgaccaccacggccactacgatcacggccacc
ggctccaccaccaacccctcctcaactccagggacaacacctatccccccagtgctgacc
accaccgccaccacacctgcagccaccagcagcacagtgactccctcctctgccctaggg
accacccacacacccccagtgccgaacaccacggccaccacacacgggcgatccctgtcc
cccagcagtccccacacggtgcgcacagcctggacttcggccacctcaggcaccttgggc
accacccacatcacagagccttccacggggacttcccacaccccagcagcaaccaccggt
accacccagcactcgactccagccctgtccagccctcaccctagcagcaggaccaccgag
tcacccccttctccagggacgaccaccccgggccacaccagggccacctccaggaccacg
gccacggccacacccagcaagacccgcacctcgaccctgctgcccagcagccccacatcg
gccccaataaccacggtggtgaccatgggctgtgagccccagtgtgcctggtcagagtgg
ctggactacagctaccccatgccggggccctctggcggggactttgacacctactccaac
atccgtgcggccggaggggccgtctgtgagcagcccctgggcctcgagtgccgtgcccag
gcccagcctggtgtccccctgcgggagttgggccaggtcgtggaatgcagcctggacttt
ggcctggtctgcaggaaccgtgagcaggtggggaagttcaagatgtgcttcaactatgaa
atccgtgtgttctgctgcaactacggccactgccccagcaccccggccaccagctctacg
gccacgccctcctccactccagggacgacctggatcctcacagagcagaccacagcagcc
actacgaccgcaaccactggatccacggccatcccgtcctccaccccgggaacagctccc
cctcccaaagtgctgaccagcacggccaccacacccacagccaccagttccaaagccact
tcctcctccagtccaaggactgcaaccacccttccagtgctgacaagcacagccaccaaa
tccacagctaccagctttacacccatcccctccttcacccttgggaccaccgggaccctc
ccagaacagaccaccacacccatggccaccatgtccacaatccacccctcctccactccg
gagaccacccacacctccacagtgctgaccacgaaggccaccacgacaagggccaccagt
tccatgtccaccccctcctccactccggggacgacctggatcctcacagagctgaccaca
gcagccactacaactgcagccactggccccacggccaccccgtcctccaccccagggacc
acctggatcctcacagagcccagcactacagccaccgtgacggtgcccaccggatccacg
gccaccgcctcctccacccgggcaactgctggcaccctcaaagtgctgaccagcacggcc
accacacccacagtcatcagctccagagccactccctcctccagtccagggactgcaacc
gcccttccagcactgagaagcacagccaccacacccacagctaccagcgttacagccatc
ccctcttcctccctgggcaccgcctggacccgcctatcacagaccaccacacccacggcc
accatgtccacagccacaccctcctctactccagagactgtccacacctccacagtgctt
accaccacgaccaccacaaccagggccaccggctctgtggccaccccctcctccacccca
ggaacagctcacactaccaaagtgccgactaccacaaccacgggcttcacagccaccccc
tcctccagcccagggacggcactcacgcctccagtgtggatcagcacaaccaccacaccc
acaaccagaggctccacggtgaccccctcctccatcccggggaccacccacaccgccaca
gtgctgaccaccaccaccacaactgtggccactggttctatggcaacaccctcctctagc
acacagaccagtggtactcccccatcactgaccaccacggccactacgatcacagccacc
ggctccaccaccaacccctcctcaactccagggacaactcccatccccccagtgctgacc
accaccgccaccacacctgcagccaccagcagcacagtgactccctcctctgccctaggg
accacccacacacccccagtgccgaacaccacggccaccacacacgggcggtccctgccc
cccagcagtccccacacggtgcgcacagcctggacttcggccacctcgggcatcttgggc
accacccacatcacagagccttccacggtgacttcccacaccccagcagcaaccaccagt
accacccagcactcgactccagccctgtccagccctcaccctagcagcaggaccaccgag
tcacccccttctccagggacgaccaccccgggccacaccaggggcacctccaggaccaca
gccacagccacacccagcaagacccgcacctcgaccctgctgcccagcagccccacatcg
gcccccataaccacggtggtgaccacgggctgtgagccccagtgtgcctggtcagagtgg
ctggactacagctaccccatgccggggccctctggcggggactttgacacctactccaac
atccgtgcggccggaggggcagtctgtgagcagcccctgggcctcgagtgccgtgcccag
gcccagcctggtgtccccctgcgggagttgggccaggtcgtggaatgcagcctggacttt
ggcctggtctgcaggaaccgtgagcaggtggggaagttcaagatgtgcttcaactatgaa
atccgtgtgttctgctgcaactacggccactgccccagcaccccggccaccagctctacg
gccacgccctcctcaactccggggacgacctggatcctcacaaagctgaccacaacagcc
actacgactgagtccactggatccacggccaccccgtcctccaccccagggaccacctgg
atcctcacagagccgagcactacagccaccgtgacggtgcccaccggatccacggccacc
gcctcctccacccaggcaactgctggcaccccacatgtgagcaccacggccacgacaccc
acagtcaccagctccaaagccactcccttctccagtccagggactgcaaccgcccttcca
gcactgagaagcacagccaccacacccacagctaccagctttacagccatcccctcctcc
tccctgggcaccacctggacccgcctatcacagaccaccacacccacggccaccatgtcc
acagccacaccctcctccactccagagactgcccacacctccacagtgcttaccaccacg
gccaccacaaccagggccaccggctctgtggccaccccctcttccaccccaggaacagct
cacactaccaaagtgccgactaccacaaccacgggcttcacagtcaccccctcctccagc
ccagggacggcacgcacgcctccagtgtggatcagcacaaccaccacacccacaaccagt
ggctccacggtgaccccctcctccgtcccggggaccacccacacccccacagtgctgacc
accaccaccacaactgtggccactggttctatggcaacaccctcctctagcacacagacc
agtggtactcccccatcactgatcaccacggccactacgatcacggccaccggctccacc
accaacccctcctcaactccagggacaacacctatccccccagtgctgaccaccaccgcc
accacacctgcagccaccagcagcacagtgactccctcctctgccctagggaccacccac
acacccccagtgccgaacaccacggccaccacacacgggcgatccctgtcccccagcagt
ccccacacggtgcgcacagcctggacttcggccacctcaggcaccttgggcaccacccac
atcacagagccttccacggggacttcccacaccccagcagcaaccaccggtaccacccag
cactcgactccagccctgtccagccctcaccctagcagcaggaccaccgagtcaccccct
tccccagggacgaccaccccgggccacaccacggccacctccaggaccacggccacggcc
acacccagcaagacccgcacctcgaccctgctgcccagcagccccacatcggcccccata
accacggtggtgaccacgggctgtgagccccagtgtgcctggtcagagtggctggactac
agctaccccatgccggggccctctggcggggactttgacacctactccaacatccgtgcg
gccggaggggccgtctgtgagcagcccctgggcctcgagtgccgtgcccaggcccagcct
ggtgtccccctgggggagttgggccaggtcgtggaatgcagcctggactttggcctggtc
tgcaggaaccgtgagcaggtggggaagttcaagatgtgcttcaactatgaaatccgtgtg
ttctgctgcaactacggccactgccccagcaccccggccaccagctctacggccatgccc
tcctccactccggggacgacctggatcctcacagagctgaccacaacagccactacgact
gcatccactggatccacggccaccccgtcctccaccccgggaacagctccccctcccaaa
gtgctgaccagcccggccaccacacccacagccaccagttccaaagccacttcctcctcc
agtccaaggactgcaaccacccttccagtgctgacaagcacagccaccaaatccacagct
accagcgttacacccatcccctcctccacccttgggaccaccgggaccctcccagaacag
accaccacacccgtggccaccatgtccacaatccacccctcctccactccggagaccacc
cacacctccacagtgctgaccacgaaggccaccacgacaagggccaccagttccacgtcc
accccctcctccactccggggacgacctggatcctcacagagctgaccacagcagccact
acaactgcagccactggccccacggccaccccgtcctccaccccagggaccacctggatc
ctcacagagctgaccacaacagccactacgactgcgtccactggatccacggccaccccg
tcctccaccccagggaccacctggatcctcacagagccgagcactacagccaccgtgacg
gtgcccaccggatccacggccaccgcctcctccacccaggcaactgctggcaccccacat
gtgagcaccacggccacgacacccacagtcaccagctccaaagccactccctcctccagt
ccagggactgcaactgcccttccagcactgagaagcacagccaccacacccacagctacc
agctttacagccatcccctcctcctccctgggcaccacctggacccgcctatcacagacc
accacacccacggccaccatgtccacagccacaccctcctccactccagagactgtccac
acctccacagtgcttaccgccacggccaccacaaccggggccaccggctctgtggccacc
ccctcctccaccccaggaacagctcacactaccaaagtgccgactaccacaaccacgggc
ttcacagccaccccctcctccagcccagggacggcactcacgcctccagtgtggatcagc
acaaccaccacacccacaaccaccacacccacaaccagtggctccacggtgaccccctcc
tccatcccggggaccacccacaccgccagagtgctgaccaccaccaccacaactgtggcc
actggttctatggcaacaccctcctctagcacacagaccagtggtactcccccatcactg
accaccacggccactacgatcacggccaccggctccaccaccaacccctcctcaactcca
gggacaacacccatcaccccagtgctgaccagcacggccaccacacccgcagccaccagc
tccaaagccacttcctcctccagtccaaggactgcaaccacccttccagtgctgacaagc
acagccacaaaatccacagctaccagctttacacccatcccctcctccaccctgtggacc
acgtggaccgtcccagcacagaccaccacacccatgtccaccatgtccacaatccacacc
tcctctactccagagaccacccacacctccacagtgctgaccaccacagccaccatgaca
agggccaccaattccacggccacaccctcctccactctggggacgacccggatcctcact
gagctgaccacaacagccactacaactgcagccactggatccacggccaccctgtcctcc
accccagggaccacctggatcctcacagagccgagcactatagccaccgtgatggtgccc
accggttccacggccaccgcctcctccactctgggaacagctcacacccccaaagtggtg
accaccatggccactatgcccacagccactgcctccacggttcccagctcgtccaccgtg
gggaccacccgcacccctgcagtgctccccagcagcctgccaaccttcagcgtgtccact
gtgtcctcctcagtcctcaccaccctgagacccactggcttccccagctcccacttctct
actccctgcttctgcagggcatttggacagtttttctcgcccggggaagtcatctacaat
aagaccgaccgagccggctgccatttctacgcagtgtgcaatcagcactgtgacattgac
cgcttccagggcgcctgtcccacctccccaccgccagtgtcctccgccccgctgtcctcg
ccctcccctgcccctggctgtgacaatgccatccctctccggcaggtgaatgagacctgg
accctggagaactgcacggtggccaggtgcgtgggtgacaaccgtgtcgtcctgctggac
ccaaagcctgtggccaacgtcacctgcgtgaacaagcacctgcccatcaaagtgtcggac
ccgagccagccctgtgacttccactatgagtgcgagtgcatctgcagcatgtggggcggc
tcccactattccacctttgacggcacctcttacaccttccggggcaactgcacctatgtc
ctcatgagagagatccatgcacgctttgggaatctcagcctctacctggacaaccactac
tgcacggcctctgccactgccgctgccgcccgctgcccccgcgccctcagcatccactac
aagtccatggatatcgtcctcactgtcaccatggtgcatgggaaggaggagggcctgatc
ctgtttgaccaaattccggtgagcagcggtttcagcaagaacggcgtgcttgtgtctgtg
ctggggaccaccaccatgcgtgtggacattcctgccctgggcgtgagcgtcaccttcaat
ggccaagtcttccaggcccggctgccctacagcctcttccacaacaacaccgagggccag
tgcggcacctgcaccaacaaccagagggacgactgtctccagcgggacggaaccactgcc
gccagttgcaaggacatggccaagacgtggctggtccccgacagcagaaaggatggctgc
tgggccccgactggcacaccccccactgccagccccgcagccccggtgtctagcacaccc
acccccaccccatgcccaccacagccgctctgtgatctgatgctgagccaggtctttgct
gagtgccacaaccttgtgcccccgggcccattcttcaacgcctgcatcagcgaccactgc
aggggccgccttgaggtgccctgccagagcctggaggcttacgcagagctctgccgcgcc
cggggagtgtgcagtgactggcgaggtgcaaccggtggcctgtgcgacctcacctgccca
cccaccaaagtgtacaagccatgcggccccatacagcctgccacctgcaactctaggaac
cagagcccacagctggaggggatggcggagggctgcttctgccctgaggaccagatcctc
ttcaacgcacacatgggcatctgcgtgcaggcctgcccctgcgtgggacccgatgggttt
cctaaatttcccggggagcggtgggtcagcaactgccagtcctgcgtgtgtgacgagggt
tcagtgtcggtgcagtgcaagcccctgccctgtgacgcccagggtcagcccccgccgtgc
aaccgtcccggcttcgtaaccgtgaccaggccccgggccgagaacccctgctgccccgag
acggtgtgcgtgtgcaacacaaccacctgcccccagagcctgcctgtgtgcccgccaggg
caggagtccatctgcacccaggaggagggcgactgctgtcccaccttccgctgcagacct
cagctgtgttcgtacaatggcaccttctacggggttggtgcaaccttcccaggcgccctt
ccctgccacatgtgtacctgcctctctggggacacccaggacccaacggtgcaatgtcag
gaggatgcctgcaacaatactacctgtccccagggctttgagtacaagagagtggccggg
cagtgctgtggggagtgcgtccagaccgcctgcctcacgcccgatggccagccagtccag
ctgaatgaaacctgggtcaacagccatgtggacaactgcaccgtgtacctctgtgaggct
gagggtggagtccatttgctgaccccacagcctgcatcctgcccagatgtgtccagctgc
agggggagcctcaggaaaaccggctgctgctactcctgtgaggaggactcctgtcaagtc
cgcatcaacacgaccatcctgtggcaccagggctgcgagaccgaggtcaacatcaccttc
tgcgagggctcctgccccggagcgtccaagtactcagcagaggcccaggccatgcagcac
cagtgcacctgctgccaggagaggcgggtccacgaggagacggtgcccttgcactgtcct
aacggctcagccatcctgcacacctacacccacgtggatgagtgtggctgcacgcccttc
tgtgtccctgcgcccatggctcccccacacacccgtggcttcccggcccaggaggccact
gctgtctga

DBGET integrated database retrieval system