KEGG   Homo sapiens (human): 728340Help
Entry
728340            CDS       T01001                                 

Gene name
GTF2H2C, GTF2H2C_2
Definition
(RefSeq) GTF2H2 family member C
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Module
hsa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    728340 (GTF2H2C)
  Replication and repair
   03420 Nucleotide excision repair
    728340 (GTF2H2C)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    728340 (GTF2H2C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     728340 (GTF2H2C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     728340 (GTF2H2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 IBR
Motif
Other DBs
NCBI-GeneID: 728340
NCBI-ProteinID: NP_001092198
HGNC: 31394
Ensembl: ENSG00000183474
Vega: OTTHUMG00000162365
Pharos: Q6P1K8(Tdark)
UniProt: Q6P1K8
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

DBGET integrated database retrieval system