KEGG   Homo sapiens (human): 728340Help
Entry
728340            CDS       T01001                                 

Gene name
GTF2H2C
Definition
GTF2H2 family member C
Orthology
K03142  
transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    728340 (GTF2H2C)
  Replication and repair
   03420 Nucleotide excision repair
    728340 (GTF2H2C)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    728340 (GTF2H2C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     728340 (GTF2H2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaaggaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatggctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatcttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgaatgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

DBGET integrated database retrieval system