KEGG   Homo sapiens (human): 728343Help
Entry
728343            CDS       T01001                                 

Gene name
NXF2B, TCP11X1, bA353J17.1
Definition
(RefSeq) nuclear RNA export factor 2B
  KO
K14284  
nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    728343 (NXF2B)
   03015 mRNA surveillance pathway
    728343 (NXF2B)
   03008 Ribosome biogenesis in eukaryotes
    728343 (NXF2B)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    728343 (NXF2B)
   05168 Herpes simplex infection
    728343 (NXF2B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     728343 (NXF2B)
   mRNA cycle factors
    Stress granule specific factors
     728343 (NXF2B)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    728343 (NXF2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9GZY0(Tdark)
UniProt: 
Position
Xq22.1
AA seq 626 aa AA seqDB search
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDV
SYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKT
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctactctaaagaagtgtgggacatacagaactgaagttgcagaatgccatgac
catggtagcacttttcaaggaagaaagaaaggtgggagttctttccgggataattttgac
aagaggagctgtcattatgaacatggtgggtatgagcgcccgccttcacactgccaggag
aatgatggaagcgtggagatgagggatgtccacaaggaccaacaactaagacacactcct
tatagcatccgatgcgaaagaagaatgaaatggcatagtgaagacgaaatccgtattacc
acgtggagaaatagaaaacctccggagagaaaaatgagtcagaacacacaggatggatac
acaaggaactggtttaaggtcacaattccttacgggataaagtatgacaaggcatggcta
atgaattcaatccagagccattgcagtgaccgcttcactccggttgatttccactacgtc
cgaaatcgggcatgcttctttgtccaggatgctagcgctgcctccgcattgaaggatgtc
agttataagatttatgatgatgagaaccaaaagatatgtatatttgtcaatcattctact
gcgccctactctgtgaagaataagttgaagccaggccaaatggagatgctaaagctgacc
atgaacaaacggtacaatgtctcccagcaagctcttgatctccagaatctccgctttgac
ccagacttgatgggccgtgacattgatataatcctgaatcgaagaaactgcatggctgcc
accctgaagatcattgaaagaaatttccctgagctgttgtctttgaacttgtgcaacaac
aagctgtaccagctggatggcctttctgacattacagagaaggctcccaaagtcaagacc
ctgaatctctccaaaaataagctggagtcggcgtgggagttgggcaaggtgaaagggctg
aagctcgaagagctatggctagaagggaacccgttgtgcagcaccttctcggaccagtcc
gcctatgtaagtgccatccgggattgtttccccaagttgttacgcctggacggccgagag
ttatccgcaccagtgattgttgacattgacagctctgagacaatgaaaccctgcaaggaa
aactttactggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtattac
tcgatctatgactctggagatcgacagggtctcctcggtgcttaccacgatgaggcctgc
ttctccttggctattcccttcgaccccaaggactcagccccgagcagcttgtgcaagtac
tttgaggatagcaggaatatgaaaacactcaaggacccctacctgaagggggaactgctg
aggcgcacaaaacgtgacattgtggactccctcagtgcgttgcccaaaactcagcatgac
ctcagctccatcctggtggacgtgtggtgccagacggaaaggatgctctgcttttctgtc
aatggggttttcaaggaagtggaaggacagtctcagggttctgttctcgccttcacccgg
accttcattgctacccctggcagcagttccagtctgtgcatcgtgaatgacgagctgttt
gtgagggatgccagcccccaagagactcagagtgccttctccatcccagtgtccacactc
tcctccagctctgagccctccctctcccaggagcagcaggaaatggtgcaggctttctct
gcccagtctgggatgaaactggagtggtctcagaagtgccttcaggacaatgagtggaac
tacactagagctggccaggccttcactatgctccagaccgagggcaagatccccgcggag
gccttcaagcaaatctcctaa

DBGET integrated database retrieval system