KEGG   Homo sapiens (human): 728400Help
Entry
728400            CDS       T01001                                 

Gene name
USP17L28
Definition
ubiquitin specific peptidase 17-like family member 28
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.1
AA seq 530 aa AA seqDB search
MEDDSLYLRGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQYPEC
LDMQPYMSQPNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
DEHLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSSTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgactcactctacttgagaggtgagtggcagttcaaccacttttcaaaactc
acatcttctcggcccgatgcagcttttgctgaaatccagcggacttctctccctgagaag
tcaccactctcatgtgagacccgtgtcgacctctgtgatgatttggctcctgtggcaaga
cagcttgctcccagggagaagcttcctctgagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacctgctacgtgaacgcttccttgcagtgcctgacatac
acaccgccccttgccaactacatgctgtcccgggagcactctcaaacgtgtcatcgtcac
aagggctgcatgctctgtactatgcaagctcacatcacacgggccctccacaatcctggc
cacgtcatccagccctcacaggcattggctgctggcttccatagaggcaagcaggaagat
gcccatgaatttctcatgttcactgtggatgccatgaaaaaggcatgccttcccgggcac
aagcaggtagatcatcactctaaggacaccaccctcatccaccaaatatttggaggctac
tggagatctcaaatcaagtgtctccactgccacggcatttcagacacttttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtccagcaagctttggaacagttg
gtgaagcccgaagaactcaatggagagaatgcctatcattgtggtgtttgtctccagagg
gcgccggcctccaagacgttaactttacacacctctgccaaggtcctcatccttgtattg
aagagattctccgatgtcacaggcaacaagattgccaagaatgtgcaatatcctgagtgc
cttgacatgcagccatacatgtctcagccgaacacaggacctctcgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaacggacattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccgaggtcaccgcctctagcatcact
tctgtcctgagtcaacaggcctacgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgtgtcaagaggcagggaaccaagagcccttggcgcagaagacaccgac
aggcgagcaacgcaaggagagctcaagagagaccacccctgcctccaggcccccgagttg
gacgagcacttggtggaaagagccactcaggaaagcaccttagaccactggaaattcctt
caagagcaaaacaaaacgaagcctgagttcaacgtcagaaaagtcgaaggtaccctgcct
cccgacgtacttgtgattcatcaatcaaaatacaagtgtgggatgaagaaccatcatcct
gaacagcaaagctccctgctaaacctctcttcgtcgaccccgacacatcaggagtccatg
aacactggcacactcgcttccctgcgagggagggccaggagatccaaagggaagaacaaa
cacagcaagagggctctgcttgtgtgccagtga

DBGET integrated database retrieval system