KEGG   Homo sapiens (human): 7291Help
Entry
7291              CDS       T01001                                 

Gene name
TWIST1, ACS3, BPES2, BPES3, CRS, CRS1, CSO, SCS, TWIST, bHLHa38
Definition
(RefSeq) twist family bHLH transcription factor 1
  KO
K09069  
twist
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Disease
H00458  
Craniosynostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7291 (TWIST1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    7291 (TWIST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p21.2
AA seq 202 aa AA seqDB search
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggacgtgtccagctcgccagtctcgccggccgacgacagcctgagcaacagc
gaggaagagccagaccggcagcagccgccgagcggcaagcgcgggggacgcaagcggcgc
agcagcaggcgcagcgcgggcggcggcgcggggcccggcggagccgcgggtgggggcgtc
ggaggcggcgacgagccgggcagcccggcccagggcaagcgcggcaagaagtctgcgggc
tgtggcggcggcggcggcgcgggcggcggcggcggcagcagcagcggcggcgggagtccg
cagtcttacgaggagctgcagacgcagcgggtcatggccaacgtgcgggagcgccagcgc
acccagtcgctgaacgaggcgttcgccgcgctgcggaagatcatccccacgctgccctcg
gacaagctgagcaagattcagaccctcaagctggcggccaggtacatcgacttcctctac
caggtcctccagagcgacgagctggactccaagatggcaagctgcagctatgtggctcac
gagcggctcagctacgccttctcggtctggaggatggagggggcctggtccatgtccgcg
tcccactag

DBGET integrated database retrieval system