KEGG   Homo sapiens (human): 7292Help
Entry
7292              CDS       T01001                                 

Gene name
TNFSF4, CD134L, CD252, GP34, OX-40L, OX4OL, TXGP1
Definition
tumor necrosis factor (ligand) superfamily, member 4
Orthology
K05469  
tumor necrosis factor ligand superfamily member 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7292 (TNFSF4)
Cellular antigens [BR:hsa04090]
 Proteins
  7292 (TNFSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25
AA seq 133 aa AA seqDB search
MVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFS
QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGEL
ILIHQNPGEFCVL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtatcacatcggtatcctcgaattcaaagtatcaaagtacaatttaccgaatataag
aaggagaaaggtttcatcctcacttcccaaaaggaggatgaaatcatgaaggtgcagaac
aactcagtcatcatcaactgtgatgggttttatctcatctccctgaagggctacttctcc
caggaagtcaacattagccttcattaccagaaggatgaggagcccctcttccaactgaag
aaggtcaggtctgtcaactccttgatggtggcctctctgacttacaaagacaaagtctac
ttgaatgtgaccactgacaatacctccctggatgacttccatgtgaatggcggagaactg
attcttatccatcaaaatcctggtgaattctgtgtcctttga

DBGET integrated database retrieval system