KEGG   Homo sapiens (human): 729201Help
Entry
729201            CDS       T01001                                 

Gene name
SPACA5B
Definition
sperm acrosome associated 5B (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 159 aa AA seqDB search
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS
SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctggggcactgtggtagtgaccttggccacgctgatggttgtcactgtggat
gccaagatctatgaacgctgcgagctggcggcaagactggagagagcagggctgaacggc
tacaagggctacggcgttggagactggctgtgcatggctcattatgagagtggctttgac
accgccttcgtggaccacaatcctgatggcagcagtgaatatggcattttccaactgaat
tctgcctggtggtgtgacaatggcattacacccaccaagaacctctgccacatggattgt
catgacctgctcaatcgccatattctggatgacatcaggtgtgccaagcagattgtgtcc
tcacagaatgggctttctgcctggacttcttggaggctacactgttctggccatgattta
tctgaatggctcaaggggtgtgatatgcatgtgaaaattgatccaaaaattcatccatga

DBGET integrated database retrieval system