KEGG   Homo sapiens (human): 7293Help
Entry
7293              CDS       T01001                                 

Gene name
TNFRSF4, ACT35, CD134, IMD16, OX40, TXGP1L
Definition
tumor necrosis factor receptor superfamily, member 4
Orthology
K05142  
tumor necrosis factor receptor superfamily member 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7293 (TNFRSF4)
Cellular antigens [BR:hsa04090]
 Proteins
  7293 (TNFRSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36
AA seq 277 aa AA seqDB search
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtgggggctcggcggctgggccgcgggccgtgtgcggctctgctcctcctgggc
ctggggctgagcaccgtgacggggctccactgtgtcggggacacctaccccagcaacgac
cggtgctgccacgagtgcaggccaggcaacgggatggtgagccgctgcagccgctcccag
aacacggtgtgccgtccgtgcgggccgggcttctacaacgacgtggtcagctccaagccg
tgcaagccctgcacgtggtgtaacctcagaagtgggagtgagcggaagcagctgtgcacg
gccacacaggacacagtctgccgctgccgggcgggcacccagcccctggacagctacaag
cctggagttgactgtgccccctgccctccagggcacttctccccaggcgacaaccaggcc
tgcaagccctggaccaactgcaccttggctgggaagcacaccctgcagccggccagcaat
agctcggacgcaatctgtgaggacagggaccccccagccacgcagccccaggagacccag
ggccccccggccaggcccatcactgtccagcccactgaagcctggcccagaacctcacag
ggaccctccacccggcccgtggaggtccccgggggccgtgcggttgccgccatcctgggc
ctgggcctggtgctggggctgctgggccccctggccatcctgctggccctgtacctgctc
cggagggaccagaggctgccccccgatgcccacaagccccctgggggaggcagtttccgg
acccccatccaagaggagcaggccgacgcccactccaccctggccaagatctga

DBGET integrated database retrieval system