KEGG   Homo sapiens (human): 7296Help
Entry
7296              CDS       T01001                                 

Gene name
TXNRD1, GRIM-12, TR, TR1, TRXR1, TXNR
Definition
thioredoxin reductase 1 (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7296 (TXNRD1)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    7296 (TXNRD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     7296 (TXNRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23-q24.1
AA seq 649 aa AA seqDB search
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgccgagggcaaggcagtggcggcggccgccccaacggagctgcagacgaaa
ggcaagaacggcgatggccgccgtaggtcagctaaagatcatcaccctggtaaaactttg
ccagagaacccagcaggattcaccagcacggccactgcagactccagagccctgcttcag
gcctatatagatggtcactctgtggtcatcttcagtaggtccacatgcacacgctgtact
gaggtaaagaagttatttaaatctctgtgtgttccttattttgtgcttgaacttgatcaa
acagaggacggtcgggccctggaaggaacgctctcggaattggccgcggaaaccgatctg
cccgttgtgtttgtgaaacagagaaagataggcggccatggtccaaccttgaaggcttat
caggagggcagacttcaaaagctactaaaaatgaacggccctgaagatcttcccaagtcc
tatgactatgaccttatcatcattggaggtggctcaggaggtctggcagctgctaaggag
gcagcccaatatggcaagaaggtgatggtcctggactttgtcactcccacccctcttgga
actagatggggtctcggaggaacatgtgtgaatgtgggttgcatacctaaaaaactgatg
catcaagcagctttgttaggacaagccctgcaagactctcgaaattatggatggaaagtc
gaggagacagttaagcatgattgggacagaatgatagaagctgtacagaatcacattggc
tctttgaattggggctaccgagtagctctgcgggagaaaaaagtcgtctatgagaatgct
tatgggcaatttattggtcctcacaggattaaggcaacaaataataaaggcaaagaaaaa
atttattcagcagagagatttctcattgccactggtgaaagaccacgttacttgggcatc
cctggtgacaaagaatactgcatcagcagtgatgatcttttctccttgccttactgcccg
ggtaagaccctggttgttggagcatcctatgtcgctttggagtgcgctggatttcttgct
ggtattggtttagacgtcactgttatggttaggtccattcttcttagaggatttgaccag
gacatggccaacaaaattggtgaacacatggaagaacatggcatcaagtttataagacag
ttcgtaccaattaaagttgaacaaattgaagcagggacaccaggccgactcagagtagta
gctcagtccaccaatagtgaggaaatcattgaaggagaatataatacggtgatgctggca
ataggaagagatgcttgcacaagaaaaattggcttagaaaccgtaggggtgaagataaat
gaaaagactggaaaaatacctgtcacagatgaagaacagaccaatgtgccttacatctat
gccattggcgatatattggaggataaggtggagctcaccccagttgcaatccaggcagga
agattgctggctcagaggctctatgcaggttccactgtcaagtgtgactatgaaaatgtt
ccaaccactgtatttactcctttggaatatggtgcttgtggcctttctgaggagaaagct
gtggagaagtttggggaagaaaatattgaggtttaccatagttacttttggccattggaa
tggacgattccgtcaagagataacaacaaatgttatgcaaaaataatctgtaatactaaa
gacaatgaacgtgttgtgggctttcacgtactgggtccaaatgctggagaagttacacaa
ggctttgcagctgcgctcaaatgtggactgaccaaaaagcagctggacagcacaattgga
atccaccctgtctgtgcagaggtattcacaacattgtctgtgaccaagcgctctggggca
agcatcctccaggctggctgctgaggttaa

DBGET integrated database retrieval system