KEGG   Homo sapiens (human): 7296Help
Entry
7296              CDS       T01001                                 

Gene name
TXNRD1, GRIM-12, TR, TR1, TRXR1, TXNR
Definition
thioredoxin reductase 1 (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hsa00450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23-q24.1
AA seq 649 aa AA seqDB search
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgccgagggcaaggcagtggcggcggccgccccaacggagctgcagacgaaa
ggcaagaacggcgatggccgccgtaggtcagctaaagatcatcaccctggtaaaactttg
ccagagaacccagcaggattcaccagcacggccactgcagactccagagccctgcttcag
gcctatatagatggtcactctgtggtcatcttcagtaggtccacatgcacacgctgtact
gaggtaaagaagttatttaaatctctgtgtgttccttattttgtgcttgaacttgatcaa
acagaggacggtcgggccctggaaggaacgctctcggaattggccgcggaaaccgatctg
cccgttgtgtttgtgaaacagagaaagataggcggccatggtccaaccttgaaggcttat
caggagggcagacttcaaaagctactaaaaatgaacggccctgaagatcttcccaagtcc
tatgactatgaccttatcatcattggaggtggctcaggaggtctggcagctgctaaggag
gcagcccaatatggcaagaaggtgatggtcctggactttgtcactcccacccctcttgga
actagatggggtctcggaggaacatgtgtgaatgtgggttgcatacctaaaaaactgatg
catcaagcagctttgttaggacaagccctgcaagactctcgaaattatggatggaaagtc
gaggagacagttaagcatgattgggacagaatgatagaagctgtacagaatcacattggc
tctttgaattggggctaccgagtagctctgcgggagaaaaaagtcgtctatgagaatgct
tatgggcaatttattggtcctcacaggattaaggcaacaaataataaaggcaaagaaaaa
atttattcagcagagagatttctcattgccactggtgaaagaccacgttacttgggcatc
cctggtgacaaagaatactgcatcagcagtgatgatcttttctccttgccttactgcccg
ggtaagaccctggttgttggagcatcctatgtcgctttggagtgcgctggatttcttgct
ggtattggtttagacgtcactgttatggttaggtccattcttcttagaggatttgaccag
gacatggccaacaaaattggtgaacacatggaagaacatggcatcaagtttataagacag
ttcgtaccaattaaagttgaacaaattgaagcagggacaccaggccgactcagagtagta
gctcagtccaccaatagtgaggaaatcattgaaggagaatataatacggtgatgctggca
ataggaagagatgcttgcacaagaaaaattggcttagaaaccgtaggggtgaagataaat
gaaaagactggaaaaatacctgtcacagatgaagaacagaccaatgtgccttacatctat
gccattggcgatatattggaggataaggtggagctcaccccagttgcaatccaggcagga
agattgctggctcagaggctctatgcaggttccactgtcaagtgtgactatgaaaatgtt
ccaaccactgtatttactcctttggaatatggtgcttgtggcctttctgaggagaaagct
gtggagaagtttggggaagaaaatattgaggtttaccatagttacttttggccattggaa
tggacgattccgtcaagagataacaacaaatgttatgcaaaaataatctgtaatactaaa
gacaatgaacgtgttgtgggctttcacgtactgggtccaaatgctggagaagttacacaa
ggctttgcagctgcgctcaaatgtggactgaccaaaaagcagctggacagcacaattgga
atccaccctgtctgtgcagaggtattcacaacattgtctgtgaccaagcgctctggggca
agcatcctccaggctggctgctgaggttaa

DBGET integrated database retrieval system