KEGG   Homo sapiens (human): 7297Help
Entry
7297              CDS       T01001                                 

Gene name
TYK2, JTK1
Definition
tyrosine kinase 2 (EC:2.7.10.2)
Orthology
K11219  
non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Jak-STAT signaling pathway
Toxoplasmosis
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Disease
H00107  
Other well-defined immunodeficiency syndromes
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 1187 aa AA seqDB search
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgccactgggggatggccaggggcagtaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gagccctgggtcactttcagtgagtcatcgctgacagctgaggaagtctgcatccacatt
gcacataaagttggtatcactcctccttgcttcaatctctttgccctcttcgatgctcag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagatgcaagcctgatg
ctatatttccgcataaggttttatttccggaactggcatggcatgaatcctcgggaaccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcatgagttt
gtgaatgacgtggcatcactgtgggagctgtcgaccgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccgccatggcatc
cccctggaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctccttccgc
cggcatatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccgggccgactctcccagcagatggtcatggtcaaataccta
gccacactcgagcggctggcaccccgcttcggcacagagcgtgtgcccgtgtgccacctg
aggctgctggcccaggccgagggggagccctgctacatccgggacagtggggtggcccct
acagaccctggccctgagtctgctgctgggcccccaacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtagaggaggaggtgaacaaggaggagggttctagt
ggcagcagtggcaggaacccccaagccagcctgtttgggaagaaggccaaggctcacaag
gcagtcggccagccggcagacaggccgcgggagccactgtgggcctacttctgtgacttc
cgggacatcacccacgtggtgctgaaagagcactgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcttgccttcccgggctgcggcgctgtccttcgtgtcgctggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccgggatgggatccacggacccctgctggagccatttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcactggagcaccagccacccc
taccgcctgatcctcacagtggcccagcgtagccaggcaccagacggcatgcagagcttg
cggctccgaaagttccccattgagcagcaggacggggccttcgtgctggagggctggggc
cggtccttccccagcgttcgggaacttggggctgccttgcagggctgcttgctgagggcc
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaat
ctcatcatcatgcggggggctcgggccagccccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtatgagggccgcctgcgagtggagggcagcggggaccctgaggagggcaag
atggatgacgaggaccccctcgtgcctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggaccctagtcaccatgacatcgccctggccttctacgagacagccagc
ctcatgagccaggtctcccacacgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacggacccctggatgtgtggctgcgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcatggtaatgtgtgtggccggaacatc
ctgctggcccggctggggttggcagagggcaccagccccttcatcaagctgagtgatcct
ggcgtgggcctgggcgccctctccagggaggagcgggtggagaggatcccctggctggcc
cccgaatgcctaccaggtggggccaacagcctaagcaccgccatggacaagtgggggttt
ggcgccaccctcctggagatctgctttgacggagaggcccctctgcagagccgcagtccc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccacag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccatcattccgc
accatcctgcgtgacctcacccggctgcagccccacaatcttgctgacgtcttgactgtg
aacccggactcaccggcgtcggaccctacggttttccacaagcgctatttgaaaaagatc
cgagatctgggcgagggtcacttcggcaaggtcagcttgtactgctacgatccgaccaac
gacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggcccccagcac
cgctcgggctggaagcaggagattgacattctgcgcacgctctaccacgagcacatcatc
aagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtcatggagtac
gtgcccctgggcagcctccgagactacctgccccggcacagcatcgggctggcccagctg
ctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcagcactacatc
caccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtcaagatcggg
gactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtgcgcgaggat
ggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataagttctactat
gcgtcagatgtctggtccttcggggtgaccctgtatgagctgctgacgcactgtgactcc
agccagagcccccccacgaaattccttgagctcataggcattgctcagggtcagatgaca
gttctgagactcactgagttgctggaacgaggggagaggctgccacggcccgacaaatgt
ccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcctttcgccca
accttcgagaacctcatacccattctgaagacagtccatgagaagtaccaaggccaggcc
ccttcagtgttcagcgtgtgctga

DBGET integrated database retrieval system