KEGG   Homo sapiens (human): 7297Help
Entry
7297              CDS       T01001                                 

Gene name
TYK2, IMD35, JTK1
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  
non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Necroptosis
Osteoclast differentiation
NOD-like receptor signaling pathway
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Toxoplasmosis
Hepatitis C
Measles
Influenza A
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Epstein-Barr virus infection
Module
JAK-STAT signaling
Disease
H00107  
Other well-defined immunodeficiency syndromes
Drug target
Tofacitinib (DG00742): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    7297 (TYK2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    7297 (TYK2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7297 (TYK2)
   04658 Th1 and Th2 cell differentiation
    7297 (TYK2)
   04659 Th17 cell differentiation
    7297 (TYK2)
  Development
   04380 Osteoclast differentiation
    7297 (TYK2)
 Human Diseases
  Infectious diseases
   05162 Measles
    7297 (TYK2)
   05164 Influenza A
    7297 (TYK2)
   05160 Hepatitis C
    7297 (TYK2)
   05168 Herpes simplex infection
    7297 (TYK2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    7297 (TYK2)
   05169 Epstein-Barr virus infection
    7297 (TYK2)
   05165 Human papillomavirus infection
    7297 (TYK2)
   05145 Toxoplasmosis
    7297 (TYK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7297 (TYK2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  JAK family [OT]
   7297 (TYK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P29597(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 1187 aa AA seqDB search
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgccactgggggatggccaggggcagtaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gagccctgggtcactttcagtgagtcatcgctgacagctgaggaagtctgcatccacatt
gcacataaagttggtatcactcctccttgcttcaatctctttgccctcttcgatgctcag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagatgcaagcctgatg
ctatatttccgcataaggttttatttccggaactggcatggcatgaatcctcgggaaccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcatgagttt
gtgaatgacgtggcatcactgtgggagctgtcgaccgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccgccatggcatc
cccctggaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctccttccgc
cggcatatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccgggccgactctcccagcagatggtcatggtcaaataccta
gccacactcgagcggctggcaccccgcttcggcacagagcgtgtgcccgtgtgccacctg
aggctgctggcccaggccgagggggagccctgctacatccgggacagtggggtggcccct
acagaccctggccctgagtctgctgctgggcccccaacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtagaggaggaggtgaacaaggaggagggttctagt
ggcagcagtggcaggaacccccaagccagcctgtttgggaagaaggccaaggctcacaag
gcagtcggccagccggcagacaggccgcgggagccactgtgggcctacttctgtgacttc
cgggacatcacccacgtggtgctgaaagagcactgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcttgccttcccgggctgcggcgctgtccttcgtgtcgctggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccgggatgggatccacggacccctgctggagccatttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcactggagcaccagccacccc
taccgcctgatcctcacagtggcccagcgtagccaggcaccagacggcatgcagagcttg
cggctccgaaagttccccattgagcagcaggacggggccttcgtgctggagggctggggc
cggtccttccccagcgttcgggaacttggggctgccttgcagggctgcttgctgagggcc
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaat
ctcatcatcatgcggggggctcgggccagccccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtatgagggccgcctgcgagtggagggcagcggggaccctgaggagggcaag
atggatgacgaggaccccctcgtgcctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggaccctagtcaccatgacatcgccctggccttctacgagacagccagc
ctcatgagccaggtctcccacacgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacggacccctggatgtgtggctgcgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcatggtaatgtgtgtggccggaacatc
ctgctggcccggctggggttggcagagggcaccagccccttcatcaagctgagtgatcct
ggcgtgggcctgggcgccctctccagggaggagcgggtggagaggatcccctggctggcc
cccgaatgcctaccaggtggggccaacagcctaagcaccgccatggacaagtgggggttt
ggcgccaccctcctggagatctgctttgacggagaggcccctctgcagagccgcagtccc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccacag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccatcattccgc
accatcctgcgtgacctcacccggctgcagccccacaatcttgctgacgtcttgactgtg
aacccggactcaccggcgtcggaccctacggttttccacaagcgctatttgaaaaagatc
cgagatctgggcgagggtcacttcggcaaggtcagcttgtactgctacgatccgaccaac
gacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggcccccagcac
cgctcgggctggaagcaggagattgacattctgcgcacgctctaccacgagcacatcatc
aagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtcatggagtac
gtgcccctgggcagcctccgagactacctgccccggcacagcatcgggctggcccagctg
ctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcagcactacatc
caccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtcaagatcggg
gactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtgcgcgaggat
ggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataagttctactat
gcgtcagatgtctggtccttcggggtgaccctgtatgagctgctgacgcactgtgactcc
agccagagcccccccacgaaattccttgagctcataggcattgctcagggtcagatgaca
gttctgagactcactgagttgctggaacgaggggagaggctgccacggcccgacaaatgt
ccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcctttcgccca
accttcgagaacctcatacccattctgaagacagtccatgagaagtaccaaggccaggcc
ccttcagtgttcagcgtgtgctga

DBGET integrated database retrieval system