KEGG   Homo sapiens (human): 730Help
Entry
730               CDS       T01001                                 

Gene name
C7
Definition
(RefSeq) complement C7
  KO
K03996  
complement component 7
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Systemic lupus erythematosus
Disease
H00103  
Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    730 (C7)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    730 (C7)
  Neurodegenerative diseases
   05020 Prion diseases
    730 (C7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P10643(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 843 aa AA seqDB search
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgataagcttattcattttggtgggatttataggagagttccaaagtttttca
agtgcctcctctccagtcaactgccagtgggacttctatgccccttggtcagaatgcaat
ggctgtaccaagactcagactcgcaggcggtcagttgctgtgtatgggcagtatggaggc
cagccttgtgttggaaatgcttttgaaacacagtcctgtgaacctacaagaggatgtcca
acagaggagggatgtggagagcgtttcaggtgcttttcaggtcagtgcatcagcaaatca
ttggtttgcaatggggattctgactgtgatgaagacagtgctgatgaagacagatgtgag
gactcagaaaggagaccttcctgtgatatcgataaacctcctcctaacatagaacttact
ggaaatggttacaatgaactcactggccagtttaggaacagagtcatcaataccaaaagt
tttggtggtcaatgtagaaaggtgtttagtggggatggaaaagatttctacaggctgagt
ggaaatgtcctgtcctatacattccaggtgaaaataaataatgattttaattatgaattt
tacaatagtacttggtcttatgtaaaacatacgtcgacagaacacacatcatctagtcgg
aagcgctccttttttagatcttcatcatcttcttcacgcagttatacttcacataccaat
gaaatccataaaggaaagagttaccaactgctggttgttgagaacactgttgaagtggct
cagttcattaataacaatccagaatttttacaacttgctgagccattctggaaggagctt
tcccacctcccctctctgtatgactacagtgcctaccgaagattaatcgaccagtacggg
acacattatctgcaatctgggtcgttaggaggagaatacagagttctattttatgtggac
tcagaaaaattaaaacaaaatgattttaattcagtcgaagaaaagaaatgtaaatcctca
ggttggcattttgtcgttaaattttcaagtcatggatgcaaggaactggaaaacgcttta
aaagctgcttcaggaacccagaacaatgtattgcgaggagaaccgttcatcagaggggga
ggtgcaggcttcatatctggccttagttacctagagctggacaatcctgctggaaacaaa
aggcgatattctgcctgggcagaatctgtgactaatcttcctcaagtcataaaacaaaag
ctgacacctttatatgagctggtaaaggaagtaccttgtgcctctgtgaaaaaactatac
ctgaaatgggctcttgaagagtatctggatgaatttgacccctgtcattgccggccttgt
caaaatggtggtttggctactgttgaggggacccattgtctgtgccattgcaaaccgtac
acatttggtgcggcgtgtgagcaaggagtcctcgtagggaatcaagcaggaggggttgat
ggaggttggagttgctggtcctcttggagcccctgtgtccaagggaagaaaacaagaagc
cgtgaatgcaataacccacctcccagtgggggtgggagatcctgcgttggagaaacgaca
gaaagcacacaatgcgaagatgaggagctggagcacttgaggttgcttgaaccacattgc
tttcctttgtctttggttccaacagaattctgtccatcacctcctgccttgaaagatgga
tttgttcaagatgaaggtacaatgtttcctgtggggaaaaatgtagtgtacacttgcaat
gaaggatactctcttattggaaacccagtggccagatgtggagaagatttacggtggctt
gttggggaaatgcattgtcagaaaattgcctgtgttctacctgtactgatggatggcata
cagagtcacccccaaaaacctttctacacagttggtgagaaggtgactgtttcctgttca
ggtggcatgtccttagaaggtccttcagcatttctctgtggctccagccttaagtggagt
cctgagatgaagaatgcccgctgtgtacaaaaagaaaatccgttaacacaggcagtgcct
aaatgtcagcgctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctacgaa
tgtggaccttccttggatgtatgtgctcaagatgagagaagcaaaaggatactgcctctg
acagtttgcaagatgcatgttctccactgtcagggtagaaattacacccttactggtagg
gacagctgtactctgcctgcctcagctgagaaagcttgtggtgcctgcccactgtgggga
aaatgtgatgctgagagcagcaaatgtgtctgccgagaagcatcggagtgcgaggaagaa
gggtttagcatttgtgtggaagtgaacggcaaggagcagacgatgtctgagtgtgaggcg
ggcgctctgagatgcagagggcagagcatctctgtcaccagcataaggccttgtgctgcg
gaaacccagtag

DBGET integrated database retrieval system