KEGG   Homo sapiens (human): 7301Help
Entry
7301              CDS       T01001                                 

Gene name
TYRO3, BYK, Dtk, Etk-2, RSE, Rek, Sky, Tif
Definition
(RefSeq) TYRO3 protein tyrosine kinase (EC:2.7.10.1)
  KO
K05116  
TYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     7301 (TYRO3)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Axl family [OT]
   7301 (TYRO3)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IX (AXL receptor family)
   7301 (TYRO3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IX (AXL receptor family)
   7301 (TYRO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15
AA seq 890 aa AA seqDB search
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVE
DGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKI
GGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSN
ASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRC
ANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKL
SWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAA
RSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE
DGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPM
VILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARN
CMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGV
TMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFT
CLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggagcatggggcggccggggctcccgccgctgccgctgccgccgcca
ccgcggctcgggctgctgctggcggctctggcttctctgctgctcccggagtccgccgcc
gcaggtctgaagctcatgggagccccggtgaagctgacagtgtctcaggggcagccggtg
aagctcaactgcagtgtggaggggatggaggagcctgacatccagtgggtgaaggatggg
gctgtggtccagaacttggaccagttgtacatcccagtcagcgagcagcactggatcggc
ttcctcagcctgaagtcagtggagcgctctgacgccggccggtactggtgccaggtggag
gatgggggtgaaaccgagatctcccagccagtgtggctcacggtagaaggtgtgccattt
ttcacagtggagccaaaagatctggcagtgccacccaatgcccctttccaactgtcttgt
gaggctgtgggtccccctgaacctgttaccattgtctggtggagaggaactacgaagatc
gggggacccgctccctctccatctgttttaaatgtaacaggggtgacccagagcaccatg
ttttcctgtgaagctcacaacctaaaaggcctggcctcttctcgcacagccactgttcac
cttcaagcactgcctgcagcccccttcaacatcaccgtgacaaagctttccagcagcaac
gctagtgtggcctggatgccaggtgctgatggccgagctctgctacagtcctgtacagtt
caggtgacacaggccccaggaggctgggaagtcctggctgttgtggtccctgtgcccccc
tttacctgcctgctccgggacctggtgcctgccaccaactacagcctcagggtgcgctgt
gccaatgccttggggccctctccctatgctgactgggtgccctttcagaccaagggtcta
gccccagccagcgctccccaaaacctccatgccatccgcacagattcaggcctcatcttg
gagtgggaagaagtgatccccgaggcccctttggaaggccccctgggaccctacaaactg
tcctgggttcaagacaatggaacccaggatgagctgacagtggaggggaccagggccaat
ttgacaggctgggatccccaaaaggacctgatcgtacgtgtgtgcgtctccaatgcagtt
ggctgtggaccctggagtcagccactggtggtctcttctcatgaccgtgcaggccagcag
ggccctcctcacagccgcacatcctgggtacctgtggtccttggtgtgctaacggccctg
gtgacggctgctgccctggccctcatcctgcttcgaaagagacggaaagagacgcggttt
gggcaagcctttgacagtgtcatggcccggggagagccagccgttcacttccgggcagcc
cggtccttcaatcgagaaaggcccgagcgcatcgaggccacattggacagcttgggcatc
agcgatgaactaaaggaaaaactggaggatgtgctcatcccagagcagcagttcaccctg
ggccggatgttgggcaaaggagagtttggttcagtgcgggaggcccagctgaagcaagag
gatggctcctttgtgaaagtggctgtgaagatgctgaaagctgacatcattgcctcaagc
gacattgaagagttcctcagggaagcagcttgcatgaaggagtttgaccatccacacgtg
gccaaacttgttggggtaagcctccggagcagggctaaaggccgtctccccatccccatg
gtcatcttgcccttcatgaagcatggggacctgcatgccttcctgctcgcctcccggatt
ggggagaacccctttaacctacccctccagaccctgatccggttcatggtggacattgcc
tgcggcatggagtacctgagctctcggaacttcatccaccgagacctggctgctcggaat
tgcatgctggcagaggacatgacagtgtgtgtggctgacttcggactctcccggaagatc
tacagtggggactactatcgtcaaggctgtgcctccaaactgcctgtcaagtggctggcc
ctggagagcctggccgacaacctgtatactgtgcagagtgacgtgtgggcgttcggggtg
accatgtgggagatcatgacacgtgggcagacgccatatgctggcatcgaaaacgctgag
atttacaactacctcattggcgggaaccgcctgaaacagcctccggagtgtatggaggac
gtgtatgatctcatgtaccagtgctggagtgctgaccccaagcagcgcccgagctttact
tgtctgcgaatggaactggagaacatcttgggccagctgtctgtgctatctgccagccag
gaccccttatacatcaacatcgagagagctgaggagcccactgcgggaggcagcctggag
ctacctggcagggatcagccctacagtggggctggggatggcagtggcatgggggcagtg
ggtggcactcccagtgactgtcggtacatactcacccccggagggctggctgagcagcca
gggcaggcagagcaccagccagagagtcccctcaatgagacacagaggcttttgctgctg
cagcaagggctactgccacacagtagctgttag

DBGET integrated database retrieval system