KEGG   Homo sapiens (human): 7307Help
Entry
7307              CDS       T01001                                 

Gene name
U2AF1, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Definition
U2 small nuclear RNA auxiliary factor 1
Orthology
K12836  
splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    7307 (U2AF1)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    7307 (U2AF1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    7307 (U2AF1)
 Complex B
    7307 (U2AF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 240 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccatcttgattcaaaacatctatcgtaatccccaaaacagtgcacag
acggctgacggctcacactgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

DBGET integrated database retrieval system