KEGG   Homo sapiens (human): 7307Help
Entry
7307              CDS       T01001                                 

Gene name
U2AF1, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Definition
U2 small nuclear RNA auxiliary factor 1
Orthology
K12836  
splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Shigellosis
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 240 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccatcttgattcaaaacatctatcgtaatccccaaaacagtgcacag
acggctgacggctcacactgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

DBGET integrated database retrieval system