KEGG   Homo sapiens (human): 731Help
Entry
731               CDS       T01001                                 

Gene name
C8A
Definition
(RefSeq) complement C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    731 (C8A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    731 (C8A)
  Neurodegenerative diseases
   05020 Prion diseases
    731 (C8A)
  Infectious diseases
   05146 Amoebiasis
    731 (C8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF Ldl_recept_a TSP_1
Motif
Other DBs
NCBI-GeneID: 731
NCBI-ProteinID: NP_000553
OMIM: 120950
HGNC: 1352
Ensembl: ENSG00000157131
Vega: OTTHUMG00000008306
Pharos: P07357(Tbio)
UniProt: P07357
Structure
PDB: 

Jmol
Position
1p32.2
AA seq 584 aa AA seqDB search
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgttgttttcttcatcttgtctttgatgacttgtcagcctggggtaactgca
caggagaaggtgaaccagagagtaagacgggcagctacacccgcagcagttacctgccag
ctgagcaactggtcagagtggacagattgctttccgtgccaggacaaaaagtaccgacac
cggagcctcttgcagccaaacaagtttgggggaaccatctgcagtggtgacatctgggat
caagccagctgctccagttctacaacttgtgtaaggcaagcacagtgtggacaggatttc
cagtgtaaggagacaggtcgctgcctgaaacgccaccttgtgtgtaatggagaccaggac
tgccttgatggctctgatgaggacgactgtgaagatgtcagggccattgacgaagactgc
agccagtatgaaccaattccaggatcacagaaggcagccttggggtacaatatcctgacc
caggaagatgctcagagtgtgtacgatgccagttattatgggggccagtgtgagacggta
tacaatggggaatggagggagcttcgatatgactccacctgtgaacgtctctactatgga
gatgatgagaaatactttcggaaaccctacaactttctgaagtaccactttgaagccctg
gcagatactggaatctcctcagagttttatgataatgcaaatgaccttctttccaaagtt
aaaaaagacaagtctgactcatttggagtgaccatcggcataggcccagccggcagccct
ttattggtgggtgtaggtgtatcccactcacaagacacttcattcttgaacgaattaaac
aagtataatgagaagaaattcattttcacaagaatcttcacaaaggtgcagactgcacat
tttaagatgaggaaggatgacattatgctggatgaaggaatgctgcagtcattaatggag
cttccagatcagtacaattatggcatgtatgccaagttcatcaatgactatggcacccat
tacatcacatctggatccatgggtggcatttatgaatatatcctggtgattgacaaagca
aaaatggaatcccttggtattaccagcagagatatcacgacatgttttggaggctccttg
ggcattcaatatgaagacaaaataaatgttggtggaggtttatcaggagaccattgtaaa
aaatttggaggtggcaaaactgaaagggccaggaaggccatggctgtggaagacattatt
tctcgggtgcgaggtggcagttctggctggagcggtggcttggcacagaacaggagcacc
attacataccgttcctgggggaggtcattaaagtataatcctgttgttatcgattttgag
atgcagcctatccacgaggtgctgcggcacacaagcctggggcctctggaggccaagcgc
cagaacctgcgccgcgccttggaccagtatctgatggaattcaatgcctgccgatgtggg
ccttgcttcaacaatggggtgcccatcctcgagggcaccagctgcaggtgccagtgccgc
ctgggtagcttgggtgctgcctgtgagcaaacacagacagaaggagccaaagcagatggg
agctggagttgctggagctcctggtctgtatgcagagcaggcatccaggaaaggagaaga
gagtgtgacaatccagcacctcagaatggaggggcctcgtgtccagggcggaaagtacag
acgcaggcttgctga

DBGET integrated database retrieval system