KEGG   Homo sapiens (human): 731Help
Entry
731               CDS       T01001                                 

Gene name
C8A
Definition
complement component 8, alpha polypeptide
Orthology
K03997  
complement component 8 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Amoebiasis
Systemic lupus erythematosus
Disease
H00103  
Late complement pathway defects
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32
AA seq 584 aa AA seqDB search
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgttgttttcttcatcttgtctttgatgacttgtcagcctggggtaactgca
caggagaaggtgaaccagagagtaagacgggcagctacacccgcagcagttacctgccag
ctgagcaactggtcagagtggacagattgctttccgtgccaggacaaaaagtaccgacac
cggagcctcttgcagccaaacaagtttgggggaaccatctgcagtggtgacatctgggat
caagccagctgctccagttctacaacttgtgtaaggcaagcacagtgtggacaggatttc
cagtgtaaggagacaggtcgctgcctgaaacgccaccttgtgtgtaatggagaccaggac
tgccttgatggctctgatgaggacgactgtgaagatgtcagggccattgacgaagactgc
agccagtatgaaccaattccaggatcacagaaggcagccttggggtacaatatcctgacc
caggaagatgctcagagtgtgtacgatgccagttattatgggggccagtgtgagacggta
tacaatggggaatggagggagcttcgatatgactccacctgtgaacgtctctactatgga
gatgatgagaaatactttcggaaaccctacaactttctgaagtaccactttgaagccctg
gcagatactggaatctcctcagagttttatgataatgcaaatgaccttctttccaaagtt
aaaaaagacaagtctgactcatttggagtgaccatcggcataggcccagccggcagccct
ttattggtgggtgtaggtgtatcccactcacaagacacttcattcttgaacgaattaaac
aagtataatgagaagaaattcattttcacaagaatcttcacaaaggtgcagactgcacat
tttaagatgaggaaggatgacattatgctggatgaaggaatgctgcagtcattaatggag
cttccagatcagtacaattatggcatgtatgccaagttcatcaatgactatggcacccat
tacatcacatctggatccatgggtggcatttatgaatatatcctggtgattgacaaagca
aaaatggaatcccttggtattaccagcagagatatcacgacatgttttggaggctccttg
ggcattcaatatgaagacaaaataaatgttggtggaggtttatcaggagaccattgtaaa
aaatttggaggtggcaaaactgaaagggccaggaaggccatggctgtggaagacattatt
tctcgggtgcgaggtggcagttctggctggagcggtggcttggcacagaacaggagcacc
attacataccgttcctgggggaggtcattaaagtataatcctgttgttatcgattttgag
atgcagcctatccacgaggtgctgcggcacacaagcctggggcctctggaggccaagcgc
cagaacctgcgccgcgccttggaccagtatctgatggaattcaatgcctgccgatgtggg
ccttgcttcaacaatggggtgcccatcctcgagggcaccagctgcaggtgccagtgccgc
ctgggtagcttgggtgctgcctgtgagcaaacacagacagaaggagccaaagcagatggg
agctggagttgctggagctcctggtctgtatgcagagcaggcatccaggaaaggagaaga
gagtgtgacaatccagcacctcagaatggaggggcctcgtgtccagggcggaaagtacag
acgcaggcttgctga

DBGET integrated database retrieval system