KEGG   Homo sapiens (human): 7320Help
Entry
7320              CDS       T01001                                 

Gene name
UBE2B, E2-17kDa, HHR6B, HR6B, RAD6B, UBC2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2B (EC:6.3.2.19)
  KO
K10574  
ubiquitin-conjugating enzyme E2 B [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7320 (UBE2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7320 (UBE2B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7320 (UBE2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7320 (UBE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 152 aa AA seqDB search
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccggcccggaggaggctcatgcgggatttcaagcggttacaagaggaccca
cctgtgggtgtcagtggcgcaccatctgaaaacaacatcatgcagtggaatgcagttata
tttggaccagaagggacaccttttgaagatggtacttttaaactagtaatagaattttct
gaagaatatccaaataaaccaccaactgttaggtttttatccaaaatgtttcatccaaat
gtgtatgctgatggtagcatatgtttagatatccttcagaatcgatggagtccaacatat
gatgtatcttctatcttaacatcaattcagtctctgctggatgaaccgaatcctaacagt
ccagccaatagccaggcagcacagctttatcaggaaaacaaacgagaatatgagaaaaga
gtttcggccattgttgaacaaagctggaatgattcataa

DBGET integrated database retrieval system