KEGG   Homo sapiens (human): 7320Help
Entry
7320              CDS       T01001                                 

Gene name
UBE2B, E2-17kDa, HHR6B, HR6B, RAD6B, UBC2
Definition
ubiquitin-conjugating enzyme E2B (EC:6.3.2.19)
Orthology
K10574  
ubiquitin-conjugating enzyme E2 B [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 152 aa AA seqDB search
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccggcccggaggaggctcatgcgggatttcaagcggttacaagaggaccca
cctgtgggtgtcagtggcgcaccatctgaaaacaacatcatgcagtggaatgcagttata
tttggaccagaagggacaccttttgaagatggtacttttaaactagtaatagaattttct
gaagaatatccaaataaaccaccaactgttaggtttttatccaaaatgtttcatccaaat
gtgtatgctgatggtagcatatgtttagatatccttcagaatcgatggagtccaacatat
gatgtatcttctatcttaacatcaattcagtctctgctggatgaaccgaatcctaacagt
ccagccaatagccaggcagcacagctttatcaggaaaacaaacgagaatatgagaaaaga
gtttcggccattgttgaacaaagctggaatgattcataa

DBGET integrated database retrieval system