KEGG   Homo sapiens (human): 7320Help
Entry
7320              CDS       T01001                                 

Gene name
UBE2B, E2-17kDa, HHR6B, HR6B, RAD6B, UBC2
Definition
ubiquitin-conjugating enzyme E2B (EC:6.3.2.19)
Orthology
K10574  
ubiquitin-conjugating enzyme E2 B [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7320 (UBE2B)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     7320 (UBE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 152 aa AA seqDB search
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccccggcccggaggaggctcatgcgggatttcaagcggttacaagaggaccca
cctgtgggtgtcagtggcgcaccatctgaaaacaacatcatgcagtggaatgcagttata
tttggaccagaagggacaccttttgaagatggtacttttaaactagtaatagaattttct
gaagaatatccaaataaaccaccaactgttaggtttttatccaaaatgtttcatccaaat
gtgtatgctgatggtagcatatgtttagatatccttcagaatcgatggagtccaacatat
gatgtatcttctatcttaacatcaattcagtctctgctggatgaaccgaatcctaacagt
ccagccaatagccaggcagcacagctttatcaggaaaacaaacgagaatatgagaaaaga
gtttcggccattgttgaacaaagctggaatgattcataa

DBGET integrated database retrieval system