KEGG   Homo sapiens (human): 7323Help
Entry
7323              CDS       T01001                                 

Gene name
UBE2D3, E2(17)KB3, UBC4/5, UBCH5C
Definition
(RefSeq) ubiquitin conjugating enzyme E2 D3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7323 (UBE2D3)
   04120 Ubiquitin mediated proteolysis
    7323 (UBE2D3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7323 (UBE2D3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7323 (UBE2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Motif
Other DBs
NCBI-GeneID: 7323
NCBI-ProteinID: NP_003331
OMIM: 602963
HGNC: 12476
Ensembl: ENSG00000109332
Vega: OTTHUMG00000131119
Pharos: P61077(Tbio)
UniProt: P61077 A0A024RDH2
Structure
PDB: 

Jmol
Position
4q24
AA seq 147 aa AA seqDB search
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggggatgatatgtttcattggcaagccacaattatgggacct
aatgacagcccatatcaaggcggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtctcgatattctaagatcacagtggtcgcctgctttaacaatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagatgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

DBGET integrated database retrieval system