KEGG   Homo sapiens (human): 7328Help
Entry
7328              CDS       T01001                                 

Gene name
UBE2H, E2-20K, GID3, UBC8, UBCH, UBCH2
Definition
(RefSeq) ubiquitin-conjugating enzyme E2H (EC:6.3.2.19)
  KO
K10576  
ubiquitin-conjugating enzyme E2 H [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7328 (UBE2H)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7328 (UBE2H)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7328 (UBE2H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q32
AA seq 113 aa AA seqDB search
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMY
LHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattttccatcccaacattgatgaagcgtcaggaactgtgtgtctagatgta
attaatcaaacttggacagctctctatgatcttaccaatatatttgagtccttcctgcct
cagttattggcctatcctaaccccatagatcctctcaatggtgacgctgcagccatgtac
ctccaccgaccagaagaatacaagcagaaaattaaagagtacatccagaaatacgccacg
gaggaggcgctgaaagaacaggaagagggtaccggggacagctcatcggagagctctatg
tctgacttttccgaagatgaggcccaggatatggagttgtag

DBGET integrated database retrieval system