KEGG   Homo sapiens (human): 733Help
Entry
733               CDS       T01001                                 

Gene name
C8G, C8C
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  
complement component 8 subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Prion diseases
Amoebiasis
Systemic lupus erythematosus
Disease
H00103  
Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    733 (C8G)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    733 (C8G)
  Neurodegenerative diseases
   05020 Prion diseases
    733 (C8G)
  Infectious diseases
   05146 Amoebiasis
    733 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P07360(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 202 aa AA seqDB search
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccctgggactgcgaccctcttgactctgctcctggcagctggctcgctgggc
cagaagcctcagaggccacgccggcccgcatcccccatcagcaccatccagcccaaggcc
aattttgatgctcagcagtttgcagggacctggctccttgtggctgtgggctccgcttgc
cgtttcctgcaggagcagggccaccgggccgaggccaccacactgcatgtggctccccag
ggcacagccatggctgtcagtaccttccgaaagctggatgggatctgctggcaggtgcgc
cagctctatggagacacaggggtcctcggccgcttcctgcttcaagcccgagacgcccga
ggggctgtgcacgtggttgtcgctgagaccgactaccagagtttcgctgtcctgtacctg
gagcgggcggggcagctgtcagtgaagctctacgcccgctcgctccctgtgagcgactcg
gtcctgagtgggtttgagcagcgggtccaggaggcccacctgactgaggaccagatcttc
tacttccccaagtacggcttctgcgaggctgcagaccagttccacgtcctggacgaagtg
aggaggtga

DBGET integrated database retrieval system