KEGG   Homo sapiens (human): 7332Help
Entry
7332              CDS       T01001                                 

Gene name
UBE2L3, E2-F1, L-UBC, UBCH7, UbcM4
Definition
ubiquitin-conjugating enzyme E2L 3 (EC:6.3.2.19)
Orthology
K04552  
ubiquitin-conjugating enzyme E2 L3 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7332 (UBE2L3)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7332 (UBE2L3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     7332 (UBE2L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 212 aa AA seqDB search
MQVAAGTRGDTRLQEVALLPQLFDLLVLGQRRARLLRQVPSALAGKDLAQLQAGATLAGY
RRAHGPEELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYP
FKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLR
ADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgctgcagggacccgaggcgacacgcgcctgcaggaggtggcactcctgccg
cagctcttcgatctgcttgtccttggccagcggcgcgctcgcctgctccgacaggtcccg
agcgcgctggcgggcaaagacttggcacagctccaggccggcgcaactctcgccgggtat
aggcgcgctcacggcccggaggagcttgaagaaatccgcaaatgtgggatgaaaaacttc
cgtaacatccaggttgatgaagctaatttattgacttggcaagggcttattgttcctgac
aaccctccatatgataagggagccttcagaatcgaaatcaactttccagcagagtaccca
ttcaaaccaccgaagatcacatttaaaacaaagatctatcacccaaacatcgacgaaaag
gggcaggtctgtctgccagtaattagtgccgaaaactggaagccagcaaccaaaaccgac
caagtaatccagtccctcatagcactggtgaatgacccccagcctgagcacccgcttcgg
gctgacctagctgaagaatactctaaggaccgtaaaaaattctgtaagaatgctgaagag
tttacaaagaaatatggggaaaagcgacctgtggactaa

DBGET integrated database retrieval system