KEGG   Homo sapiens (human): 7347Help
Entry
7347              CDS       T01001                                 

Gene name
UCHL3, UCH-L3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     7347 (UCHL3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   7347 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q22.2
AA seq 194 aa AA seqDB search
MDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACG
TIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQ
TEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERD
PDELRFNAIALSAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgaactccttagcatggtaccaagaccagtctgtgcagtcttacttctcttt
cctattacagaaaagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcag
ggacaagatgttacatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtgga
acaattggactgattcatgctattgcaaacaataaagacaagatgcactttgaatctgga
tcaaccttgaaaaaattcctggaggaatctgtgtcaatgagccctgaagaacgagccaga
tacctggagaactatgatgccatccgagttactcatgagaccagtgcccatgaaggtcag
actgaggcaccaagtatagatgagaaagtagatcttcattttattgcattagttcatgta
gatgggcatctctatgaattagatgggcggaagccatttccaattaaccatggtgaaact
agtgatgaaactttattagaggatgccatagaagtttgcaagaagtttatggagcgcgac
cctgatgaactaagatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system