KEGG   Homo sapiens (human): 7350Help
Entry
7350              CDS       T01001                                 

Gene name
UCP1, SLC25A7, UCP
Definition
uncoupling protein 1 (mitochondrial, proton carrier)
Orthology
K08769  
solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    7350 (UCP1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    7350 (UCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q28-q31
AA seq 307 aa AA seqDB search
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggggcctgacagcctcggacgtacacccgaccctgggggtccagctcttctcagct
ggaatagcggcgtgcttggcggacgtgatcaccttcccgctggacacggccaaagtccgg
ctccaggtccaaggtgaatgcccgacgtccagtgttattaggtataaaggtgtcctggga
acaatcaccgctgtggtaaaaacagaagggcggatgaaactctacagcgggctgcctgcg
gggcttcagcggcaaatcagctccgcctctctcaggatcggcctctacgacacggtccag
gagttcctcaccgcagggaaagaaacagcacctagtttaggaagcaagattttagctggt
ctaacgactggaggagtggcagtattcattgggcaacccacagaggtcgtgaaagtcaga
cttcaagcacagagccatctccacggaatcaaacctcgctacacggggacttataatgcg
tacagaataatagcaacaaccgaaggcttgacgggtctttggaaagggactactcccaat
ctgatgagaagtgtcatcatcaattgtacagagctagtaacatatgatctaatgaaggag
gcctttgtgaaaaacaacatattagcagatgacgtcccctgccacttggtgtcggctctt
atcgctggattttgcgcaacagctatgtcctccccggtggatgtagtaaaaaccagattt
attaattctccaccaggacagtacaaaagtgtgcccaactgtgcaatgaaagtgttcact
aacgaaggaccaacggctttcttcaaggggttggtaccttccttcttgcgacttggatcc
tggaacgtcattatgtttgtgtgctttgaacaactgaaacgagaactgtcaaagtcaagg
cagactatggactgtgccacataa

DBGET integrated database retrieval system