KEGG   Homo sapiens (human): 7350Help
Entry
7350              CDS       T01001                                 

Gene name
UCP1, SLC25A7, UCP
Definition
(RefSeq) uncoupling protein 1
  KO
K08769  
solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Apelin signaling pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    7350 (UCP1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    7350 (UCP1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    7350 (UCP1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   7350 (UCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P25874(Tbio)
UniProt: 
Position
4q31.1
AA seq 307 aa AA seqDB search
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggggcctgacagcctcggacgtacacccgaccctgggggtccagctcttctcagct
ggaatagcggcgtgcttggcggacgtgatcaccttcccgctggacacggccaaagtccgg
ctccaggtccaaggtgaatgcccgacgtccagtgttattaggtataaaggtgtcctggga
acaatcaccgctgtggtaaaaacagaagggcggatgaaactctacagcgggctgcctgcg
gggcttcagcggcaaatcagctccgcctctctcaggatcggcctctacgacacggtccag
gagttcctcaccgcagggaaagaaacagcacctagtttaggaagcaagattttagctggt
ctaacgactggaggagtggcagtattcattgggcaacccacagaggtcgtgaaagtcaga
cttcaagcacagagccatctccacggaatcaaacctcgctacacggggacttataatgcg
tacagaataatagcaacaaccgaaggcttgacgggtctttggaaagggactactcccaat
ctgatgagaagtgtcatcatcaattgtacagagctagtaacatatgatctaatgaaggag
gcctttgtgaaaaacaacatattagcagatgacgtcccctgccacttggtgtcggctctt
atcgctggattttgcgcaacagctatgtcctccccggtggatgtagtaaaaaccagattt
attaattctccaccaggacagtacaaaagtgtgcccaactgtgcaatgaaagtgttcact
aacgaaggaccaacggctttcttcaaggggttggtaccttccttcttgcgacttggatcc
tggaacgtcattatgtttgtgtgctttgaacaactgaaacgagaactgtcaaagtcaagg
cagactatggactgtgccacataa

DBGET integrated database retrieval system