KEGG   Homo sapiens (human): 7351Help
Entry
7351              CDS       T01001                                 

Gene name
UCP2, BMIQ4, SLC25A8, UCPH
Definition
(RefSeq) uncoupling protein 2
  KO
K15103  
solute carrier family 25 (mitochondrial uncoupling protein), member 8/9
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   7351 (UCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q13
AA seq 309 aa AA seqDB search
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR
GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS
PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
ACTSREAPF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggttgggttcaaggccacagatgtgccccctactgccactgtgaagtttcttggggct
ggcacagctgcctgcatcgcagatctcatcacctttcctctggatactgctaaagtccgg
ttacagatccaaggagaaagtcaggggccagtgcgcgctacagccagcgcccagtaccgc
ggtgtgatgggcaccattctgaccatggtgcgtactgagggcccccgaagcctctacaat
gggctggttgccggcctgcagcgccaaatgagctttgcctctgtccgcatcggcctgtat
gattctgtcaaacagttctacaccaagggctctgagcatgccagcattgggagccgcctc
ctagcaggcagcaccacaggtgccctggctgtggctgtggcccagcccacggatgtggta
aaggtccgattccaagctcaggcccgggctggaggtggtcggagataccaaagcaccgtc
aatgcctacaagaccattgcccgagaggaagggttccggggcctctggaaagggacctct
cccaatgttgctcgtaatgccattgtcaactgtgctgagctggtgacctatgacctcatc
aaggatgccctcctgaaagccaacctcatgacagatgacctcccttgccacttcacttct
gcctttggggcaggcttctgcaccactgtcatcgcctcccctgtagacgtggtcaagacg
agatacatgaactctgccctgggccagtacagtagcgctggccactgtgcccttaccatg
ctccagaaggaggggccccgagccttctacaaagggttcatgccctcctttctccgcttg
ggttcctggaacgtggtgatgttcgtcacctatgagcagctgaaacgagccctcatggct
gcctgcacttcccgagaggctcccttctga

DBGET integrated database retrieval system