KEGG   Homo sapiens (human): 7353Help
Entry
7353              CDS       T01001                                 

Gene name
UFD1, UFD1L
Definition
(RefSeq) ubiquitin recognition factor in ER associated degradation 1
  KO
K14016  
ubiquitin fusion degradation protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
p97-Ufd1-Npl4 complex
HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7353 (UFD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92890(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 307 aa AA seqDB search
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLN
ITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVA
TYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAV
SIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKK
GVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSL
RKKGRKP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttctctttcaacatgttcgaccaccctattcccagggtcttccaaaaccgcttctcc
acacagtaccgctgcttctctgtgtccatgctagcagggcctaatgacaggtcagatgtg
gagaaaggagggaagataattatgccaccctcggccctggaccaactcagccgacttaac
attacctatcccatgctgttcaaactgaccaataagaattcggaccgcatgacgcattgt
ggcgtgctggagtttgtggctgatgagggcatctgctacctcccacactggatgatgcag
aacttactcttggaagaaggcggcctggtccaggtggagagcgtcaaccttcaagtggcc
acctactccaaattccaacctcagagccctgacttcctggacatcaccaaccccaaagcc
gtattagaaaacgcacttaggaactttgcctgtctgaccaccggggatgtgattgccatc
aactataatgaaaagatctacgaactgcgtgtgatggagaccaaacccgacaaggcagtg
tccatcattgagtgtgacatgaacgtggactttgatgctcccctgggctacaaagaaccc
gaaagacaagtccagcatgaggagtcgacagaaggtgaagccgaccacagtggctatgct
ggagagctgggcttccgcgctttctctggatctggcaatagactggatggaaagaagaaa
ggggtagagcccagcccctccccaatcaagcctggagatattaaaagaggaattcccaat
tatgaatttaaacttggtaagataactttcatcagaaattcacgtccccttgtcaaaaag
gttgaagaggatgaagctggaggcagattcgtcgctttctctggagaaggacagtcattg
cgtaaaaagggaagaaagccctaa

DBGET integrated database retrieval system