KEGG   Homo sapiens (human): 7357Help
Entry
7357              CDS       T01001                                 

Gene name
UGCG, GCS, GLCT1
Definition
UDP-glucose ceramide glucosyltransferase (EC:2.4.1.80)
Orthology
K00720  
ceramide glucosyltransferase [EC:2.4.1.80]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Lactosylceramide biosynthesis
Drug target
Miglustat: 
Eliglustat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    7357 (UGCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.80  ceramide glucosyltransferase
     7357 (UGCG)
Glycosyltransferases [BR:hsa01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   7357 (UGCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q31
AA seq 394 aa AA seqDB search
MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggacctggccttggagggaatggccgtcttcgggttcgtcctcttcttg
gtgctgtggctgatgcatttcatggctatcatctacacccgattacacctcaacaagaag
gcaactgacaaacagccttatagcaagctcccaggtgtctctcttctgaaaccactgaaa
ggggtagatcctaacttaatcaacaacctggaaacattctttgaattggattatcccaaa
tatgaagtgctcctttgtgtacaagatcatgatgatccagccattgatgtatgtaagaag
cttcttggaaaatatccaaatgttgatgctagattgtttataggtggtaaaaaagttggc
attaatcctaaaattaataatttaatgccaggatatgaagttgcaaagtatgatcttata
tggatttgtgatagtggaataagagtaattccagatacgcttactgacatggtgaatcaa
atgacagaaaaagtaggcttggttcacgggctgccttacgtagcagacagacagggcttt
gctgccaccttagagcaggtatattttggaacttcacatccaagatactatatctctgcc
aatgtaactggtttcaaatgtgtgacaggaatgtcttgtttaatgagaaaagatgtgttg
gatcaagcaggaggacttatagcttttgctcagtacattgccgaagattactttatggcc
aaagcgatagctgaccgaggttggaggtttgcaatgtccactcaagttgcaatgcaaaac
tctggctcatattcaatttctcagtttcaatccagaatgatcaggtggaccaaactacga
attaacatgcttcctgctacaataatttgtgagccaatttcagaatgctttgttgccagt
ttaattattggatgggcagcccaccatgtgttcagatgggatattatggtatttttcatg
tgtcattgcctggcatggtttatatttgactacattcaactcaggggtgtccagggtggc
acactgtgtttttcaaaacttgattatgcagtcgcctggttcatccgcgaatccatgaca
atatacatttttttgtctgcattatgggacccaactataagctggagaactggtcgctac
agattacgctgtgggggtacagcagaggaaatcctagatgtataa

DBGET integrated database retrieval system