KEGG   Homo sapiens (human): 7358Help
Entry
7358              CDS       T01001                                 

Gene name
UGDH, GDH, UDP-GlcDH, UDPGDH, UGD
Definition
(RefSeq) UDP-glucose 6-dehydrogenase (EC:1.1.1.22)
  KO
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7358 (UGDH)
   00053 Ascorbate and aldarate metabolism
    7358 (UGDH)
   00500 Starch and sucrose metabolism
    7358 (UGDH)
   00520 Amino sugar and nucleotide sugar metabolism
    7358 (UGDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     7358 (UGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.1
AA seq 494 aa AA seqDB search
MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEV
VESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNS
NGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLI
GGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISAL
CEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYW
QQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDE
GAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIP
KFSLQDPPNKKPKV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaattaagaagatctgttgcatcggtgcaggctatgttggaggacccacatgt
agtgtcattgctcatatgtgtcctgaaatcagggtaacggttgttgatgtcaatgaatca
agaatcaatgcgtggaattctcctacacttcctatttatgagccaggactaaaagaagtg
gtagaatcctgtcgaggaaaaaatctttttttttctaccaatattgatgatgccatcaaa
gaagctgatcttgtatttatttctgtgaatactccaacaaaaacctatggaatggggaaa
ggccgggcagcagatctgaagtatattgaagcttgtgctagacgcattgtgcaaaactca
aatgggtacaaaattgtgactgagaaaagcacagttccagtgcgggcagcagaaagtatc
cgtcgcatatttgatgcaaacacaaaacccaacttgaatttacaggtgctgtccaaccct
gagtttctggcagagggaacagccatcaaggacctaaagaacccagacagagtactgatt
ggaggggatgaaactccagagggccagagagctgtgcaggccctgtgtgctgtatatgag
cactgggttcccagagaaaagatcctcaccactaatacttggtcttcagagctttccaaa
ctggcagcaaatgcttttcttgcccagagaataagcagcattaactccataagtgctctg
tgtgaagcaacaggagctgatgtagaagaggtagcaacagcgattggaatggaccagaga
attggaaacaagtttctaaaagccagtgttgggtttggtgggagctgtttccaaaaggat
gttctgaatttggtttatctctgtgaggctctgaatttgccagaagtagctcgttattgg
cagcaggtcatagacatgaatgactaccagaggaggaggtttgcttcccggatcatagat
agtctgtttaatacagtaactgataagaagatagctattttgggatttgcattcaaaaag
gacactggtgatacaagagaatcttctagtatatatattagcaaatatttgatggatgaa
ggtgcacatctacatatatatgatccaaaagtacctagggaacaaatagttgtggatctt
tctcatccaggtgtttcagaggatgaccaagtgtcccggctcgtgaccatttccaaggat
ccatatgaagcatgtgatggtgcccatgctgttgttatttgcactgagtgggacatgttt
aaggaattggattatgaacgcattcataaaaaaatgctaaagccagcctttatcttcgat
ggacggcgtgtcctggatgggctccacaatgaactacaaaccattggcttccagattgaa
acaattggcaaaaaggtgtcttcaaagagaattccatatgctccttctggtgaaattccg
aagtttagtcttcaagatccacctaacaagaaacctaaagtgtag

DBGET integrated database retrieval system