KEGG   Homo sapiens (human): 7360Help
Entry
7360              CDS       T01001                                 

Gene name
UGP2, UDPG, UDPGP, UDPGP2, UGP1, UGPP1, UGPP2, pHC379
Definition
UDP-glucose pyrophosphorylase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7360 (UGP2)
   00052 Galactose metabolism
    7360 (UGP2)
   00500 Starch and sucrose metabolism
    7360 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    7360 (UGP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     7360 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p14-p13
AA seq 497 aa AA seqDB search
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGP
SVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIG
VRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQS
RYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSN
IDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVP
KAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETA
VGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK
LGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPG
AVLENKIVSGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatggtgcttctcagttccaagaagtcattcggcaagagctagaattatct
gtgaagaaggaactagaaaaaatactcaccacagcatcatcacatgaatttgagcacacc
aaaaaagacctggatggatttcggaagctatttcatagatttttgcaagaaaaggggcct
tctgtggattggggaaaaatccagagaccccctgaagattcgattcaaccctatgaaaag
ataaaggccaggggcttgcctgataatatatcttccgtgttgaacaaactagtggtggtg
aaactcaatggtggtttgggaaccagcatgggctgcaaaggccctaaaagtctgattggt
gtgaggaatgagaatacctttctggatctgactgttcagcaaattgaacatttgaataaa
acctacaatacagatgttcctcttgttttaatgaactcttttaacacggatgaagatacc
aaaaaaatactacagaagtacaatcattgtcgtgtgaaaatctacactttcaatcaaagc
aggtacccgaggattaataaagaatctttacttcctgtagcaaaggacgtgtcttactca
ggggaaaatacagaagcttggtaccctccaggtcatggtgatatttacgccagtttctac
aactctggattgcttgatacctttataggagaaggcaaagagtatatttttgtgtctaac
atagataatctgggtgccacagtggatctgtatattcttaatcatctaatgaacccaccc
aatggaaaacgctgtgaatttgtcatggaagtcacaaataaaacacgtgcagatgtaaag
ggcgggacactcactcaatatgaaggcaaactgagactggtggaaattgctcaagtgcca
aaagcacatgtagacgagttcaagtctgtatcaaagttcaaaatatttaatacaaacaac
ctatggatttctcttgcagcagttaaaagactgcaggagcaaaatgccattgacatggaa
atcattgtgaatgcaaagactttggatggaggcctgaatgtcattcaattagaaactgca
gtaggggctgccatcaaaagttttgagaattctctaggtattaatgtgccaaggagccgt
tttctgcctgtcaaaaccacatcagatctcttgctggtgatgtcaaacctctatagtctt
aatgcaggatctctgacaatgagtgaaaagcgggaatttcctacagtgcccttggttaaa
ttaggcagttcttttacgaaggttcaagattatctaagaagatttgaaagtataccagat
atgcttgaattggatcacctcacagtttcaggagatgtgacatttggaaaaaatgtttca
ttaaagggaacggttatcatcattgcaaatcatggtgacagaattgatatcccacctgga
gcagtattagagaacaagattgtgtctggaaaccttcgcatcttggaccactga

DBGET integrated database retrieval system