KEGG   Homo sapiens (human): 7360Help
Entry
7360              CDS       T01001                                 

Gene name
UGP2, UDPG, UDPGP, UDPGP2, UGP1, UGPP1, UGPP2, pHC379
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Module
hsa_M00361  Nucleotide sugar biosynthesis, eukaryotes
hsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7360 (UGP2)
   00052 Galactose metabolism
    7360 (UGP2)
   00500 Starch and sucrose metabolism
    7360 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    7360 (UGP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     7360 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 7360
NCBI-ProteinID: NP_006750
OMIM: 191760
HGNC: 12527
Ensembl: ENSG00000169764
Vega: OTTHUMG00000129513
Pharos: Q16851(Tbio)
UniProt: Q16851
Structure
PDB: 

Jmol
Position
2p15
AA seq 508 aa AA seqDB search
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatttgtacaagatcttagcaaagcaatgtctcaagatggtgcttctcagttc
caagaagtcattcggcaagagctagaattatctgtgaagaaggaactagaaaaaatactc
accacagcatcatcacatgaatttgagcacaccaaaaaagacctggatggatttcggaag
ctatttcatagatttttgcaagaaaaggggccttctgtggattggggaaaaatccagaga
ccccctgaagattcgattcaaccctatgaaaagataaaggccaggggcttgcctgataat
atatcttccgtgttgaacaaactagtggtggtgaaactcaatggtggtttgggaaccagc
atgggctgcaaaggccctaaaagtctgattggtgtgaggaatgagaatacctttctggat
ctgactgttcagcaaattgaacatttgaataaaacctacaatacagatgttcctcttgtt
ttaatgaactcttttaacacggatgaagataccaaaaaaatactacagaagtacaatcat
tgtcgtgtgaaaatctacactttcaatcaaagcaggtacccgaggattaataaagaatct
ttacttcctgtagcaaaggacgtgtcttactcaggggaaaatacagaagcttggtaccct
ccaggtcatggtgatatttacgccagtttctacaactctggattgcttgatacctttata
ggagaaggcaaagagtatatttttgtgtctaacatagataatctgggtgccacagtggat
ctgtatattcttaatcatctaatgaacccacccaatggaaaacgctgtgaatttgtcatg
gaagtcacaaataaaacacgtgcagatgtaaagggcgggacactcactcaatatgaaggc
aaactgagactggtggaaattgctcaagtgccaaaagcacatgtagacgagttcaagtct
gtatcaaagttcaaaatatttaatacaaacaacctatggatttctcttgcagcagttaaa
agactgcaggagcaaaatgccattgacatggaaatcattgtgaatgcaaagactttggat
ggaggcctgaatgtcattcaattagaaactgcagtaggggctgccatcaaaagttttgag
aattctctaggtattaatgtgccaaggagccgttttctgcctgtcaaaaccacatcagat
ctcttgctggtgatgtcaaacctctatagtcttaatgcaggatctctgacaatgagtgaa
aagcgggaatttcctacagtgcccttggttaaattaggcagttcttttacgaaggttcaa
gattatctaagaagatttgaaagtataccagatatgcttgaattggatcacctcacagtt
tcaggagatgtgacatttggaaaaaatgtttcattaaagggaacggttatcatcattgca
aatcatggtgacagaattgatatcccacctggagcagtattagagaacaagattgtgtct
ggaaaccttcgcatcttggaccactga

DBGET integrated database retrieval system