KEGG   Homo sapiens (human): 7363Help
Entry
7363              CDS       T01001                                 

Gene name
UGT2B4, HLUG25, UDPGT2B4, UDPGTH1, UGT2B11
Definition
UDP glucuronosyltransferase 2 family, polypeptide B4 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7363 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    7363 (UGT2B4)
   00500 Starch and sucrose metabolism
    7363 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    7363 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7363 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    7363 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7363 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    7363 (UGT2B4)
   00983 Drug metabolism - other enzymes
    7363 (UGT2B4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    7363 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    7363 (UGT2B4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7363 (UGT2B4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7363 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatataaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcatcttcagct
tccatttctttcgatcccaacagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctgttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacgcaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatatgatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
tactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgtccagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gatcttcttggtcacccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttccacacaatg
tcgagtacagacttactcaatgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaaccagtgaagccccttgatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgactgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgttaga
acaggaaagaaggggaaaagagattaa

DBGET integrated database retrieval system