KEGG   Homo sapiens (human): 7364Help
Entry
7364              CDS       T01001                                 

Gene name
UGT2B7, UDPGT_2B9, UDPGT2B7, UDPGTH2, UGT2B9
Definition
UDP glucuronosyltransferase 2 family, polypeptide B7 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7364 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    7364 (UGT2B7)
   00500 Starch and sucrose metabolism
    7364 (UGT2B7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    7364 (UGT2B7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7364 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    7364 (UGT2B7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7364 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    7364 (UGT2B7)
   00983 Drug metabolism - other enzymes
    7364 (UGT2B7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    7364 (UGT2B7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7364 (UGT2B7)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7364 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q13
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatacagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
ttaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcaatatttggt
gacataactagaaagttctgtaaagatgtagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacgtcatttttgcagatgctatttttccctgtagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctacgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacgtatggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagactttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagccctggcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtggggattccattgtttgccgatcaacct
gataacattgctcacatgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcattgaagagagtaattaatgatccttcatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggtctgt
gtggcaactgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagtttgct
agaaaagcaaagaagggaaaaaatgattag

DBGET integrated database retrieval system