KEGG   Homo sapiens (human): 7366Help
Entry
7366              CDS       T01001                                 

Gene name
UGT2B15, HLUG4, UDPGT_2B8, UDPGT2B15, UDPGTH3, UGT2B8
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B15
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7366 (UGT2B15)
   00053 Ascorbate and aldarate metabolism
    7366 (UGT2B15)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    7366 (UGT2B15)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7366 (UGT2B15)
   00860 Porphyrin and chlorophyll metabolism
    7366 (UGT2B15)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7366 (UGT2B15)
   00982 Drug metabolism - cytochrome P450
    7366 (UGT2B15)
   00983 Drug metabolism - other enzymes
    7366 (UGT2B15)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    7366 (UGT2B15)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7366 (UGT2B15)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7366 (UGT2B15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 7366
NCBI-ProteinID: NP_001067
OMIM: 600069
HGNC: 12546
Ensembl: ENSG00000196620
Vega: OTTHUMG00000161507
Pharos: P54855(Tbio)
UniProt: P54855
Position
4q13.2
AA seq 530 aa AA seqDB search
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
STLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEY
YDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgatacagctcagttgttactttagctct
ggaagctgtggaaaggtgctagtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaggggtcatgaggtgactgtgttgacatcttcggct
tctactcttgtcaatgccagtaaatcatctgctattaaattagaagtttatcctacatct
ttaactaaaaattatttggaagattctcttctgaaaattctcgatagatggatatatggt
gtttcaaaaaatacattttggtcatatttttcacaattacaagaattgtgttgggaatat
tatgactacagtaacaagctctgtaaagatgcagttttgaataagaaacttatgatgaaa
ctacaagagtcaaagtttgatgtcattctggcagatgcccttaatccctgtggtgagcta
ctggctgaactatttaacataccctttctgtacagtcttcgattctctgttggctacaca
tttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgattttcatggagaggataaaaaatatgatacatatgctttat
tttgacttttggtttcaaatttatgatctgaagaagtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccctgcctaaggaaatggaagagtttgtgcagagctct
ggagaaaatggtattgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agtgccaacatgattgcatcagcccttgcccagatcccacaaaaggttctatggagattt
gatggcaagaagccaaatactttaggttccaatactcgactgtacaagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcatggtggaaccaatggc
atctatgaggcgatctaccatgggatccctatggtgggcattcccttgtttgcggatcaa
catgataacattgctcacatgaaagccaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaatgcattgaagtcagtcattaatgaccctgtctataaa
gagaatgtcatgaaattatcaagaattcatcatgaccaaccaatgaagcccctggatcga
gcagtcttctggattgagtttgtcatgcgccacaaaggagccaagcaccttcgagtcgca
gctcacaacctcacctggatccagtaccactctttggatgtgatagcattcctgctggcc
tgcgtggcaactgtgatatttatcatcacaaaattttgcctgttttgtttccgaaagctt
gccaaaaaaggaaagaagaagaaaagagattag

DBGET integrated database retrieval system