KEGG   Homo sapiens (human): 7371Help
Entry
7371              CDS       T01001                                 

Gene name
UCK2, TSA903, UK, UMPK
Definition
uridine-cytidine kinase 2 (EC:2.7.1.48)
Orthology
K00876  
uridine kinase [EC:2.7.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7371 (UCK2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7371 (UCK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     7371 (UCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 261 aa AA seqDB search
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRK
EETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG
CLNGYTPSRKRQASESSSRPH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccggggacagcgagcagaccctgcagaaccaccagcagcccaacggcggcgagccc
ttccttataggcgtcagcgggggaacagctagcggcaagtcttccgtgtgtgctaagatc
gtgcagctcctggggcagaatgaggtggactatcgccagaagcaggtggtcatcctgagc
caggatagcttctaccgtgtccttacctcggagcagaaggccaaagccctgaagggccag
ttcaactttgaccacccggatgcctttgacaatgaactcattctcaaaacactcaaagaa
atcactgaagggaaaacagtccagatccccgtgtatgactttgtctcccattcccggaag
gaggagacagttactgtctatcccgcagacgtggtgctctttgaagggatcctggccttc
tactcccaggaggtacgagacctgttccagatgaagctttttgtggatacagatgcggac
acccggctctcacgcagagtattaagggacatcagcgagagaggcagggatcttgagcag
attttatctcagtacattacgttcgtcaagcctgcctttgaggaattctgcttgccaaca
aagaagtatgctgatgtgatcatccctagaggtgcagataatctggtggccatcaacctc
atcgtgcagcacatccaggacatcctgaatggagggccctccaaacggcagaccaatggc
tgtctcaacggctacaccccttcacgcaagaggcaggcatcggagtccagcagcaggccg
cattga

DBGET integrated database retrieval system