KEGG   Homo sapiens (human): 7371Help
Entry
7371              CDS       T01001                                 

Gene name
UCK2, TSA903, UK, UMPK
Definition
(RefSeq) uridine-cytidine kinase 2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7371 (UCK2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7371 (UCK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     7371 (UCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRK CoaE AAA_18 Zeta_toxin Cytidylate_kin AAA_17 T3SS_needle_reg AAA_26
Motif
Other DBs
NCBI-GeneID: 7371
NCBI-ProteinID: NP_036606
OMIM: 609329
HGNC: 12562
Ensembl: ENSG00000143179
Vega: OTTHUMG00000040117
Pharos: Q9BZX2(Tbio)
UniProt: Q9BZX2 A0A024R912
Structure
PDB: 

Jmol
Position
1q24.1
AA seq 261 aa AA seqDB search
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRK
EETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG
CLNGYTPSRKRQASESSSRPH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccggggacagcgagcagaccctgcagaaccaccagcagcccaacggcggcgagccc
ttccttataggcgtcagcgggggaacagctagcggcaagtcttccgtgtgtgctaagatc
gtgcagctcctggggcagaatgaggtggactatcgccagaagcaggtggtcatcctgagc
caggatagcttctaccgtgtccttacctcggagcagaaggccaaagccctgaagggccag
ttcaactttgaccacccggatgcctttgacaatgaactcattctcaaaacactcaaagaa
atcactgaagggaaaacagtccagatccccgtgtatgactttgtctcccattcccggaag
gaggagacagttactgtctatcccgcagacgtggtgctctttgaagggatcctggccttc
tactcccaggaggtacgagacctgttccagatgaagctttttgtggatacagatgcggac
acccggctctcacgcagagtattaagggacatcagcgagagaggcagggatcttgagcag
attttatctcagtacattacgttcgtcaagcctgcctttgaggaattctgcttgccaaca
aagaagtatgctgatgtgatcatccctagaggtgcagataatctggtggccatcaacctc
atcgtgcagcacatccaggacatcctgaatggagggccctccaaacggcagaccaatggc
tgtctcaacggctacaccccttcacgcaagaggcaggcatcggagtccagcagcaggccg
cattga

DBGET integrated database retrieval system