KEGG   Homo sapiens (human): 7372Help
Entry
7372              CDS       T01001                                 

Gene name
UMPS, OPRT
Definition
uridine monophosphate synthetase (EC:2.4.2.10 4.1.1.23)
Orthology
K13421  
uridine monophosphate synthetase [EC:2.4.2.10 4.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Disease
H00198  
Orotic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7372 (UMPS)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7372 (UMPS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     7372 (UMPS)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     7372 (UMPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13
AA seq 480 aa AA seqDB search
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgctcgtgcagctttggggccattggtgacgggtctgtacgacgtgcaggct
ttcaagtttggggacttcgtgctgaagagcgggctttcctcccccatctacatcgatctg
cggggcatcgtgtctcgaccgcgtcttctgagtcaggttgcagatattttattccaaact
gcccaaaatgcaggcatcagttttgacaccgtgtgtggagtgccttatacagctttgcca
ttggctacagttatctgttcaaccaatcaaattccaatgcttattagaaggaaagaaaca
aaggattatggaactaagcgtcttgtagaaggaactattaatccaggagaaacctgttta
atcattgaagatgttgtcaccagtggatctagtgttttggaaactgttgaggttcttcag
aaggagggcttgaaggtcactgatgccatagtgctgttggacagagagcagggaggcaag
gacaagttgcaggcgcacgggatccgcctccactcagtgtgtacattgtccaaaatgctg
gagattctcgagcagcagaaaaaagttgatgctgagacagttgggagagtgaagaggttt
attcaggagaatgtctttgtggcagcgaatcataatggttctcccctttctataaaggaa
gcacccaaagaactcagcttcggtgcacgtgcagagctgcccaggatccacccagttgca
tcgaagcttctcaggcttatgcaaaagaaggagaccaatctgtgtctatctgctgatgtt
tcactggccagagagctgttgcagctagcagatgctttaggacctagtatctgcatgctg
aagactcatgtagatattttgaatgattttactctggatgtgatgaaggagttgataact
ctggcaaaatgccatgagttcttgatatttgaagaccggaagtttgcagatataggaaac
acagtgaaaaagcagtatgaaggaggtatctttaaaatagcttcctgggcagatctagta
aatgctcacgtggtgccaggctcaggagttgtgaaaggcctgcaagaagtgggcctgcct
ttgcatcgggggtgcctccttattgcggaaatgagctccaccggctccctggccactggg
gactacactagagcagcggttagaatggctgaggagcactctgaatttgttgttggtttt
atttctggctcccgagtaagcatgaaaccagaatttcttcacttgactccaggagttcag
ttggaagcaggaggagataatcttggccaacagtacaatagcccacaagaagttattggc
aaacgaggttccgatatcatcattgtaggtcgtggcataatctcagcagctgatcgtctg
gaagcagcagagatgtacagaaaagctgcttgggaagcgtatttgagtagacttggtgtt
tga

DBGET integrated database retrieval system