KEGG   Homo sapiens (human): 7372Help
Entry
7372              CDS       T01001                                 

Gene name
UMPS, OPRT, RP11-71H17.9
Definition
uridine monophosphate synthetase (EC:2.4.2.10 4.1.1.23)
Orthology
K13421  
uridine monophosphate synthetase [EC:2.4.2.10 4.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Disease
H00198  
Orotic aciduria
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13
AA seq 480 aa AA seqDB search
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgctcgtgcagctttggggccattggtgacgggtctgtacgacgtgcaggct
ttcaagtttggggacttcgtgctgaagagcgggctttcctcccccatctacatcgatctg
cggggcatcgtgtctcgaccgcgtcttctgagtcaggttgcagatattttattccaaact
gcccaaaatgcaggcatcagttttgacaccgtgtgtggagtgccttatacagctttgcca
ttggctacagttatctgttcaaccaatcaaattccaatgcttattagaaggaaagaaaca
aaggattatggaactaagcgtcttgtagaaggaactattaatccaggagaaacctgttta
atcattgaagatgttgtcaccagtggatctagtgttttggaaactgttgaggttcttcag
aaggagggcttgaaggtcactgatgccatagtgctgttggacagagagcagggaggcaag
gacaagttgcaggcgcacgggatccgcctccactcagtgtgtacattgtccaaaatgctg
gagattctcgagcagcagaaaaaagttgatgctgagacagttgggagagtgaagaggttt
attcaggagaatgtctttgtggcagcgaatcataatggttctcccctttctataaaggaa
gcacccaaagaactcagcttcggtgcacgtgcagagctgcccaggatccacccagttgca
tcgaagcttctcaggcttatgcaaaagaaggagaccaatctgtgtctatctgctgatgtt
tcactggccagagagctgttgcagctagcagatgctttaggacctagtatctgcatgctg
aagactcatgtagatattttgaatgattttactctggatgtgatgaaggagttgataact
ctggcaaaatgccatgagttcttgatatttgaagaccggaagtttgcagatataggaaac
acagtgaaaaagcagtatgaaggaggtatctttaaaatagcttcctgggcagatctagta
aatgctcacgtggtgccaggctcaggagttgtgaaaggcctgcaagaagtgggcctgcct
ttgcatcgggggtgcctccttattgcggaaatgagctccaccggctccctggccactggg
gactacactagagcagcggttagaatggctgaggagcactctgaatttgttgttggtttt
atttctggctcccgagtaagcatgaaaccagaatttcttcacttgactccaggagttcag
ttggaagcaggaggagataatcttggccaacagtacaatagcccacaagaagttattggc
aaacgaggttccgatatcatcattgtaggtcgtggcataatctcagcagctgatcgtctg
gaagcagcagagatgtacagaaaagctgcttgggaagcgtatttgagtagacttggtgtt
tga

DBGET integrated database retrieval system