KEGG   Homo sapiens (human): 7375Help
Entry
7375              CDS       T01001                                 

Gene name
USP4, UNP, Unph
Definition
ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     7375 (USP4)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   7375 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 313 aa AA seqDB search
MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKVSFFLPRL
ECNGAILAHCNFCLPGSSNSPASASRVAPSHLANFFFFEMESHSVTKLECGGAVSAYSRV
QVMLLPQPPEWLG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagactcagaagtccgagctt
ggacccttaatgaggaccacactccaacgcggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggt
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccctaccgaggcg
tggaataaactactaaactggtacggctgtgtagaaggccagcaacccatcgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtcgaggtgtatttgctggaactg
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaagagatgcggaagctattcaacatccctgcggagcgtgaa
acacggctctggaacaaatacatgagcaacacctacgagcagttgagcaagctagacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagcctcaaaatgaa
gatggcacatggcccaggcagaccttgcagtcaaaagtttcgttctttttgcccaggctg
gagtgcaatggcgcgatcttggctcactgcaacttctgcctcccgggttcaagcaattct
cctgcctcagcttcccgagtagcgccatcacatctggctaatttttttttttttgagatg
gagtctcactctgtcaccaagctggagtgcggtggtgcagtctcggcttactcccgggtt
caagtgatgcttctgccccagcctcccgagtggctgggatga

DBGET integrated database retrieval system