KEGG   Homo sapiens (human): 7375Help
Entry
7375              CDS       T01001                                 

Gene name
USP4, UNP, Unph
Definition
(RefSeq) ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.4.19.12)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     7375 (USP4)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   7375 (USP4)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    7375 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 963 aa AA seqDB search
MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASAL
YGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGED
EEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADI
NSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSM
DTN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagactcagaagtccgagctt
ggacccttaatgaggaccacactccaacgcggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggt
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccctaccgaggcg
tggaataaactactaaactggtacggctgtgtagaaggccagcaacccatcgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtcgaggtgtatttgctggaactg
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaagagatgcggaagctattcaacatccctgcggagcgtgaa
acacggctctggaacaaatacatgagcaacacctacgagcagttgagcaagctagacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagcctcaaaatgaa
gatggcacatggcccaggcagaccttgcagtcaaaatcaagcactgcgcctagcagaaat
tttactacctctccaaaatcatcagcaagtccctattcctcagtgtctgcctctctcatt
gcaaatggtgatagcactagcacctgtgggatgcacagttccggtgtcagcaggggtgga
tctggcttttctgcttcgtataattgtcaggagccaccatcctctcatatacaacctggg
ctctgtggacttggaaacctgggaaacacctgcttcatgaactccgctttgcagtgtttg
agcaacactgcaccactgactgactactttctcaaagatgagtatgaagccgaaatcaac
agagacaaccctctggggatgaaaggggaaattgcagaagcctatgctgaactcattaag
cagatgtggtctggaagggacgcccatgtggcacctcgcatgttcaaaactcaagtagga
cgttttgctcctcaattttctggctaccagcaacaagattctcaggagctgctggccttt
cttctagatggattgcatgaagatctgaaccgggtaaagaaaaagccctacttggagctg
aaggatgccaatgggcggccagatgcggtggtggcaaaggaagcctgggagaatcacagg
ttgaggaatgattctgtgattgtggatactttccatggcctcttcaaatctactttggtt
tgcccagaatgtgctaaggtttctgtgacctttgacccattttgctatctaacgctgcca
ctgcccttgaagaaagatcgagttatggaggttttcctggttcctgctgaccctcactgc
agacctactcagtaccgtgtgactgtgccgctgatgggggctgtgtccgacctgtgcgag
gctctctccaggctgtctggcattgctgcagaaaatatggtggtcgcagatgtgtataat
caccgattccacaaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gacattttcgtgtacgaggtctgcagcacttccgtggatggctcggaatgtgtcacgctt
ccagtctacttcagggagaggaagtccaggccatcaagcacttcctccgcatcagcgcta
tatgggcagccactattgctttctgtccccaagcacaagttaacccttgagtctttgtac
caggctgtttgtgatcgtatcagccgctatgtgaaacagcctttacctgatgagtttggc
agctcacccttggagccaggggcctgcaatggctccaggaacagctgtgaaggagaagat
gaggaagaaatggagcatcaggaagaaggcaaagagcagctttcagaaacagaaggcagt
ggggaagatgagccaggaaatgaccccagtgagaccacccaaaagaagatcaaaggccag
ccctgcccaaaaaggctttttaccttcagtcttgtgaactcctatggaacagctgacata
aattcacttgcagctgatggaaaactacttaaactcaactctcgatctacactggccatg
gattgggacagtgaaactcggagactttactatgatgagcaagaatctgaggcctacgag
aagcatgtgagcatgttgcagcctcagaagaagaagaagaccacagtggccctgagagac
tgcatcgagctcttcaccaccatggagacccttggggagcatgacccctggtactgtccc
aactgtaagaagcatcaacaggccacaaaaaagtttgacctatggtccttgcccaagatc
ctggtggtccacctcaaacgtttctcctacaacagatactggagggataagctcgacaca
gtcgtagaattcccaatcagagggctgaacatgtccgagtttgtctgtaacctgtcagca
aggccttatgtgtacgacctcattgccgtgtccaatcattatggagccatgggggttggc
cactacactgcatatgcgaagaacaaactgaatggtaaatggtattactttgatgatagc
aacgtgtccctggcctctgaggatcagatagtgactaaagcagcttatgtgctattttac
caacgtcgagatgatgaattttataagacaccttcacttagcagttctggttcctctgat
ggagggacacgaccaagcagctctcagcagggctttggggatgatgaggcttgcagcatg
gacaccaactaa

DBGET integrated database retrieval system