KEGG   Homo sapiens (human): 7376Help
Entry
7376              CDS       T01001                                 

Gene name
NR1H2, LXR-b, LXRB, NER, NER-I, RIP15, UNR
Definition
(RefSeq) nuclear receptor subfamily 1 group H member 2
  KO
K08535  
liver X receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    7376 (NR1H2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7376 (NR1H2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   7376 (NR1H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 461 aa AA seqDB search
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
RRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcctaccacgagttccctggatacccccctgcctggaaatggcccccctcag
cctggcgccccttcttcttcacccactgtaaaggaggagggtccggagccgtggcccggg
ggtccggaccctgatgtcccaggcactgatgaggccagctcagcctgcagcacagactgg
gtcatcccagatcccgaagaggaaccagagcgcaagcgaaagaagggcccagccccgaag
atgctgggccacgagctttgccgtgtctgtggggacaaggcctccggcttccactacaac
gtgctcagctgcgaaggctgcaagggcttcttccggcgcagtgtggtccgtggtggggcc
aggcgctatgcctgccggggtggcggaacctgccagatggacgctttcatgcggcgcaag
tgccagcagtgccggctgcgcaagtgcaaggaggcagggatgagggagcagtgcgtcctt
tctgaagaacagatccggaagaagaagattcggaaacaacagcagcaggagtcacagtca
cagtcgcagtcacctgtggggccgcagggcagcagcagctcagcctctgggcctggggct
tcccctggtggatctgaggcaggcagccagggctccggggaaggcgagggtgtccagcta
acagcggctcaagaactaatgatccagcagttggtggcggcccaactgcagtgcaacaaa
cgctccttctccgaccagcccaaagtcacgccctggcccctgggcgcagacccccagtcc
cgagatgcccgccagcaacgctttgcccacttcacggagctggccatcatctcagtccag
gagatcgtggacttcgctaagcaagtgcctggtttcctgcagctgggccgggaggaccag
atcgccctcctgaaggcatccactatcgagatcatgctgctagagacagccaggcgctac
aaccacgagacagagtgtatcaccttcttgaaggacttcacctacagcaaggacgacttc
caccgtgcaggcctgcaggtggagttcatcaaccccatcttcgagttctcgcgggccatg
cggcggctgggcctggacgacgctgagtacgccctgctcatcgccatcaacatcttctcg
gccgaccggcccaacgtgcaggagccgggccgcgtggaggcgttgcagcagccctacgtg
gaggcgctgctgtcctacacgcgcatcaagaggccgcaggaccagctgcgcttcccgcgc
atgctcatgaagctggtgagcctgcgcacgctgagctctgtgcactcggagcaggtcttc
gccttgcggctccaggacaagaagctgccgcctctgctgtcggagatctgggacgtccac
gagtga

DBGET integrated database retrieval system