KEGG   Homo sapiens (human): 7378Help
Entry
7378              CDS       T01001                                 

Gene name
UPP1, UDRPASE, UP, UPASE, UPP
Definition
uridine phosphorylase 1 (EC:2.4.2.3)
Orthology
K00757  
uridine phosphorylase [EC:2.4.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    7378 (UPP1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7378 (UPP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     7378 (UPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p12.3
AA seq 310 aa AA seqDB search
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacgggagccaatgcagagaaagctgaaagtcacaatgattgccccgtcaga
cttttaaatccaaacatagcaaaaatgaaagaagatattctctatcatttcaatctcacc
actagcagacacaatttcccagccttgtttggagatgtgaagtttgtgtgtgttggtgga
agcccctcccggatgaaagccttcatcaggtgcgttggtgcagagctgggccttgactgc
ccaggtagagactatcccaacatctgtgcgggaactgaccgctatgccatgtataaagta
ggaccggtgctgtctgtcagtcatggtatgggcattccttctatctcaatcatgttgcat
gagctcataaagctgctgtactatgcccggtgctccaacgtcactatcatccgcattggc
acttctggtgggataggtctggagcccggcactgtggtcataacagagcaggcagtggat
acctgcttcaaggcagagtttgagcagattgtcctggggaagcgggtcatccggaaaacg
gaccttaacaagaagctggtgcaggagctgttgctgtgttctgcagagctgagcgagttc
accacagtggtggggaacaccatgtgcaccttggacttctatgaagggcaaggccgtctg
gatggggctctctgctcctacacggagaaggacaagcaggcgtatctggaggcagcctat
gcagccggcgtccgcaatatcgagatggagtcctcggtgtttgccgccatgtgcagcgcc
tgcggcctccaagcggccgtggtgtgtgtcaccctcctgaaccgcctggaaggggaccag
atcagcagccctcgcaatgtgctcagcgagtaccagcagaggccgcagcggctggtgagc
tacttcatcaagaagaaactgagcaaggcctga

DBGET integrated database retrieval system