KEGG   Homo sapiens (human): 7389Help
Entry
7389              CDS       T01001                                 

Gene name
UROD, PCT, UPD
Definition
uroporphyrinogen decarboxylase (EC:4.1.1.37)
Orthology
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Disease
H00202  
Hepatic porphyria
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34
AA seq 367 aa AA seqDB search
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaatgggttgggacctcagggttttccggagctgaagaatgacacattcctg
cgagcagcctggggagaggaaacagactacactcccgtttggtgcatgcgccaggcaggc
cgttacttaccagagtttagggaaacccgggctgcccaggactttttcagcacgtgtcgc
tctcctgaggcctgctgtgaactgactctgcagccactgcgtcgcttccctctggatgct
gccatcattttctccgacatccttgttgtaccccaggcactgggcatggaggtgaccatg
gtacctggcaaaggacccagcttcccagagccattaagagaagagcaggacctagaacgc
ctacgggatccagaagtggtagcctctgagctaggctatgtgttccaagccatcaccctt
acccgacaacgactggctggacgtgtgccgctgattggctttgctggtgccccatggacc
ctgatgacatacatggttgagggtggtggctcaagcaccatggctcaggccaagcgctgg
ctctatcagagacctcaggctagtcaccagctgcttcgcatcctcactgatgctctggtc
ccatatctggtaggacaagtggtggctggtgcccaggcattgcagctgtttgagtcccat
gcagggcatcttggcccacagctcttcaacaagtttgcactgccttacatccgtgatgtg
gccaagcaagtgaaggccaggttgcgggaggcaggcctggcaccagtgcccatgatcatc
tttgctaaggatgggcattttgccctggaggagctggcccaagctggctatgaggtggtt
gggcttgactggacagtggccccaaagaaagcccgggagtgtgtggggaagacggtgaca
ttgcagggcaacctggacccctgtgccttgtatgcatctgaggaggagatcgggcagttg
gtgaagcagatgctggatgactttggaccacatcgctacattgccaacctgggccatggg
ctttatcctgacatggacccagaacatgtgggcgcctttgtggatgctgtgcataaacac
tcacgtctgcttcgacagaactga

DBGET integrated database retrieval system