KEGG   Homo sapiens (human): 7389Help
Entry
7389              CDS       T01001                                 

Gene name
UROD, PCT, UPD
Definition
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
Disease
H00201  Erythropoietic porphyria (EP)
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    7389 (UROD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     7389 (UROD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: URO-D
Motif
Other DBs
NCBI-GeneID: 7389
NCBI-ProteinID: NP_000365
OMIM: 613521
HGNC: 12591
Ensembl: ENSG00000126088
Vega: OTTHUMG00000008949
Pharos: P06132(Tbio)
UniProt: P06132
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 367 aa AA seqDB search
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaatgggttgggacctcagggttttccggagctgaagaatgacacattcctg
cgagcagcctggggagaggaaacagactacactcccgtttggtgcatgcgccaggcaggc
cgttacttaccagagtttagggaaacccgggctgcccaggactttttcagcacgtgtcgc
tctcctgaggcctgctgtgaactgactctgcagccactgcgtcgcttccctctggatgct
gccatcattttctccgacatccttgttgtaccccaggcactgggcatggaggtgaccatg
gtacctggcaaaggacccagcttcccagagccattaagagaagagcaggacctagaacgc
ctacgggatccagaagtggtagcctctgagctaggctatgtgttccaagccatcaccctt
acccgacaacgactggctggacgtgtgccgctgattggctttgctggtgccccatggacc
ctgatgacatacatggttgagggtggtggctcaagcaccatggctcaggccaagcgctgg
ctctatcagagacctcaggctagtcaccagctgcttcgcatcctcactgatgctctggtc
ccatatctggtaggacaagtggtggctggtgcccaggcattgcagctgtttgagtcccat
gcagggcatcttggcccacagctcttcaacaagtttgcactgccttacatccgtgatgtg
gccaagcaagtgaaggccaggttgcgggaggcaggcctggcaccagtgcccatgatcatc
tttgctaaggatgggcattttgccctggaggagctggcccaagctggctatgaggtggtt
gggcttgactggacagtggccccaaagaaagcccgggagtgtgtggggaagacggtgaca
ttgcagggcaacctggacccctgtgccttgtatgcatctgaggaggagatcgggcagttg
gtgaagcagatgctggatgactttggaccacatcgctacattgccaacctgggccatggg
ctttatcctgacatggacccagaacatgtgggcgcctttgtggatgctgtgcataaacac
tcacgtctgcttcgacagaactga

DBGET integrated database retrieval system