KEGG   Homo sapiens (human): 7399Help
Entry
7399              CDS       T01001                                 

Gene name
USH2A, RP39, US2, USH2, dJ1111A8.1
Definition
(RefSeq) usherin
  KO
K19636  
usherin
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
H00779  
Usher syndrome (US)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q41
AA seq 5202 aa AA seqDB search
MNCPVLSLGSGFLFQVIEMLIFAYFASISLTESRGLFPRLENVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSASFIFGNHKSCFSSPPSPKLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFNAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNNFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVYAFNCKPCQCNSHSKSCHYNISVDPFPFEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDTVGTRNGSILCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDHCNFGFKFLRSFNDVGCEPCQCNLHGSVNKFCNPHSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGNFYLRQNN
SFLCLPCNCDKTGTINGSLLCNKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQHCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQRCDQCKDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLDTDLLPYTKYSYYIETTNVHGSTRSVAVT
YKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYDFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKMQKISSTELH
VEWSPPAELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPHSFVESANENALKPP
QTMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDINMLSEQSPQQSIPMAFSQLLHTAKSQELSYTVEGLKPYRIY
EFTITLCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLKWFPPEELNGPSPIY
QLERRESSLPALMTTMMKGIRFIGNGYCKFPSSTHPVNTDFTGIKASFRTKVPEGLIVFA
ASPGNQEEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHEIIAIRHQAFGQ
ITLDGIYTGSSAILNGSTVIGDNTGVFLGGLPRSYTILRKDPEIIQKGFVGCLKDVHFMK
NYNPSAIWEPLDWQSSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHPYMFHGGMNFEI
SFKFRTDQLNGLLLFVYNKDGPDFLAMELKSGILTFRLNTSLAFTQVDLLLGLSYCNGKW
NKVIIKKEGSFISASVNGLMKHASESGDQPLVVNSPVYVGGIPQELLNSYQHLCLEQGFG
GCMKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVYQGKEQSVYEGG
LQPFTEYLYRVIASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGYSIEVTWDEPVV
RGVIEKYILKAYSEDSTRPPRMPSASAEFVNTSNLTGILTGLLPFKNYAVTLTACTLAGC
TESSHALNISTPQEAPQEVQPPVAKSLPSSLLLSWNPPKKANGIITQYCLYMDGRLIYSG
SEENYTVTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSPVLTVLDSRTIH
IQWKQPRKISGILERYVLYMSNHTHDFTIWSVIYNSTELFQDHMLQYVLPGNKYLIKLGA
CTGGGCTVSEASEALTDEDIPEGVPAPKAHSYSPDSFNVSWTEPEYPNGVITSYGLYLDG
ILIHNSSELSYRAYGFAPWSLHSFRVQACTAKGCALGPLVENRTLEAPPEGTVNVFVKTQ
GSRKAHVRWEAPFRPNGLLTHSVLFTGIFYVDPVGNNYTLLNVTKVMYSGEETNLWVLID
GLVPFTNYTVQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSSATPTSLQVVWSTPAR
NNAPGSPRYQLQMRSGDSTHGFLELFSNPSASLSYEVSDLQPYTEYMFRLVASNGFGSAH
SSWIPFMTAEDKPGPVVPPILLDVKSRMMLVTWQHPRKSNGVITHYNIYLHGRLYLRTPG
NVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPSPELFSDTPTSV
IISWQPPTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSALSPWTKYEYRV
LMSTLHGGTNSSAWVEVTTRPSRPAGVQPPVVTVLEPDAVQVTWKPPLIQNGDILSYEIH
MPDPHITLTNVTSAVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTYVTTHPTV
PQNVGPLSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNPPEDLNRWHNIY
SGTQWLYEDKGLSRFTTYEYMLFVHNSVGFTPSREVTVTTLAGLPERGANLTASVLNHTA
IDVRWAKPTVQDLQGEVEYYTLFWSSATSNDSLKILPDVNSHVIGHLKPNTEYWIFISVF
NGVHSINSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSIYVNNK
LYKTGMNVPGSFILRDLSPFTIYDIQVEVCTIYACVKSNGTQITTVEDTPSDIPTPTIRG
ITSRSLQIDWVSPRKPNGIILGYDLLWKTWYPCAKTQKLVQDQSDELCKAVRCQKPESIC
GHICYSSEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCGGRIQEAQPNHQCCSGY
YARILPGEVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDGHGQKCCGRQIV
SNDLECCGGEEGVVYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHIKKNDPVPVKCCE
TELIPKSQKCCNGVGYNPLKYVCSDKISTGMMMKETKECRILCPASMEATEHCGRCDFNF
TSHICTVIRGSHNSTGKASIEEMCSSAEETIHTGSVNTYSYTDVNLKPYMTYEYRISAWN
SYGRGLSKAVRARTKEDVPQGVSPPTWTKIDNLEDTIVLNWRKPIQSNGPIIYYILLRNG
IERFRGTSLSFSDKEGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGVPESILPPSITA
LSAVALHLSWSVPEKSNGVIKEYQIRQVGKGLIHTDTTDRRQHTVTGLQPYTNYSFTLTA
CTSAGCTSSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPNGLVSQYQLSRN
GNLLFLGGSEEQNFTDKNLEPNSRYTYKLEVKTGGGSSASDDYIVQTPMSTPEEIYPPYN
ITVIGPYSIFVAWIPPGILIPEIPVEYNVLLNDGSVTPLAFSVGHHQSTLLENLTPFTQY
EIRIQACQNGSCGVSSRMFVKTPEAAPMDLNSPVLKALGSACIEIKWMPPEKPNGIIINY
FIYRRPAGIEEESVLFVWSEGALEFMDEGDTLRPFTLYEYRVRACNSKGSVESLWSLTQT
LEAPPQDFPAPWAQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDPTFNSPTVHAFT
VKGTSHQAHLYGLEPFTTYRIGVVAANHAGEILSPWTLIQTLESSPSGLRNFIVEQKENG
RALLLQWSEPMRTNGVIKTYNIFSDGFLEYSGLNRQFLFRRLDPFTLYTLTLEACTRAGC
AHSAPQPLWTDEAPPDSQLAPTVHSVKSTSVELSWSEPVNPNGKIIRYEVIRRCFEGKAW
GNQTIQADEKIVFTEYNTERNTFMYNDTGLQPWTQCEYKIYTWNSAGHTCSSWNVVRTLQ
APPEGLSPPVISYVSMNPQKLLISWIPPEQSNGIIQSYRLQRNEMLYPFSFDPVTFNYTD
EELLPFSTYSYALQACTSGGCSTSKPTSITTLEAAPSEVSPPDLWAVSATQMNVCWSPPT
VQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNFSLVACTNGGCTASVSKSAWTM
EALPENMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTGLETRYRDFTLT
PGVEYSYTVTASNSQGGILSPLVKDRTSPSAPSGMEPPKLQARGPQEILVNWDPPVRTNG
DIINYTLFIRELFERETKIIHINTTHNSFGMQSYIVNQLKPFHRYEIRIQACTTLGCASS
DWTFIQTPEIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQIATQ
PRKSNPVLIYNGSSTSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCRTGPAPPEGLRA
PTFHVISSTQAVVNISAPGKPNGIVSLYRLFSSSAHGAETVLSEGMATQQTLHGLQAFTN
YSIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIGTLASRTASFRWSPPMFPNGVIH
SYELQFHVACPPDSALPCTPSQIETKYTGLGQKASLGGLQPYTTYKLRVVAHNEVGSTAS
EWISFTTQKELPQYRAPFSVDSNLSVVCVNWSDTFLLNGQLKEYVLTDGGRRVYSGLDTT
LYIPRTADKTFFFQVICTTDEGSVKTPLIQYDTSTGLGLVLTTPGKKKGSRSKSTEFYSE
LWFIVLMAMLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPLNVYPPGENHMG
LADTKIPRSGTPVSIRSNRSACVLRIPSQNQTSLTYSQGSLHRSVSQLMDIQDKKVLMDN
SLWEAIMGHNSGLYVDEEDLMNAIKDFSSVTKERTTFTDTHL
NT seq 15609 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcccagttctttcattgggctctggcttcttgtttcaggtcattgaaatgttg
atctttgcctattttgcttcaatatccttgactgagtcacgaggtcttttcccaaggctg
gagaacgtgggagctttcaagaaagtttccatcgtgccaacccaagcagtatgtggactc
ccagaccgaagcactttttgtcacagctctgctgctgctgaaagtattcagttctgtacc
cagcggttttgtattcaggattgcccatacagatcttcacaccctacctacactgccctt
ttctcagcaggcctcagtagctgcatcacaccagacaagaatgatctgcatcctaacgcc
catagcaattctgcaagttttatttttggaaatcacaagagctgcttttcttctcctcct
tctccaaagctgatggcatcatttaccttagctgtatggctgaaacctgagcaacaaggt
gtaatgtgtgttatagaaaagacagtagatgggcagattgtgttcaaacttacaatatct
gagaaagagaccatgttttattatcgcacagtaaatggtttgcaacctccaataaaagta
atgacactggggagaattcttgtgaagaaatggattcatcttagtgtgcaggtgcatcag
acaaaaatcagcttctttatcaatggcgtggagaaggatcatacacctttcaatgcaaga
actctaagtggttcaattacagattttgcatctggtactgtgcaaataggacagagttta
aatggtttagagcagtttgtcggaagaatgcaagattttcgattataccaagtggcactt
acaaacagagagattctggaagtcttctctggagatcttctcagattgcatgcccaatca
cattgccgttgccctggcagccacccgcgggtccaccctttggcacagcggtactgcatt
cctaatgatgcaggagacacagctgataatagagtgtcacggttgaatcctgaagcccat
cctctctcttttgtcaatgataatgatgttggtacttcatgggtttcaaatgtgtttaca
aacattacacagcttaatcaaggagtgactatttcagttgatttggaaaatggacagtat
caggtgttttatattatcattcagttctttagtccacaaccaacggaaataaggattcaa
aggaagaaggaaaatagtttagattgggaggactggcaatattttgccaggaattgtggt
gcttttggaatgaaaaacaatggagatttggaaaaacctgattctgtcaactgtcttcag
ctttccaattttactccatattcccgtggcaatgtcacatttagcatcctgacacctgga
ccaaattatcgtcctggatacaataacttctataataccccatctcttcaagagttcgta
aaagccacgcaaataaggtttcattttcatgggcagtactatacaactgagactgctgtt
aacctcagacacagatattatgcagtggacgaaatcaccattagtgggagatgtcagtgc
catggtcatgccgataactgcgacacaacaagccagccatatagatgcctctgctcccag
gagagcttcactgaaggacttcattgtgatcgctgcttgcctctttataatgacaagcct
ttccgccaaggtgatcaagtttacgctttcaattgtaaaccttgtcaatgcaacagccat
tccaaaagctgccattacaacatctctgtagacccatttccttttgagcacttcagaggg
ggaggaggagtttgtgatgattgtgagcataacactacaggaaggaactgtgagctgtgc
aaggattactttttccgacaagttggtgcagatccttcggccatagatgtttgcaaaccc
tgtgactgtgatacagttggcactagaaatggtagcattctttgtgatcagattggagga
cagtgtaattgtaagagacacgtgtctggcaggcagtgcaatcagtgccagaatggattc
tacaatctacaagagttggatcctgatggctgcagtccctgtaactgcaatacctctggg
acagtggatggagatattacctgtcaccaaaattcaggccagtgcaagtgcaaagcaaac
gttattgggcttaggtgtgatcattgcaattttggatttaaatttctccgaagctttaat
gatgttggatgtgagccctgccagtgtaacctccatggctcagtgaacaaattctgcaat
cctcactctgggcagtgtgagtgcaaaaaagaagccaaaggacttcagtgtgacacctgc
agagaaaacttttatgggttagatgtcaccaattgtaaggcctgtgactgtgacacagct
ggatccctccctgggactgtctgtaatgctaagacagggcagtgcatctgcaagcccaat
gttgaagggagacagtgcaataaatgtttggagggaaacttctacctacggcaaaataat
tctttcctctgtctgccttgcaactgtgataagactgggacaataaatggctctctgctg
tgtaacaaatcaacaggacaatgtccttgcaaattaggggtaacaggtcttcgctgtaat
cagtgtgagcctcacaggtacaatttgaccattgacaattttcaacactgccagatgtgt
gagtgtgattccttggggacattacctgggaccatttgtgacccaatcagtggccagtgc
ctgtgtgtgcctaatcgtcaaggaagaaggtgtaatcagtgtcaaccaggtttttatatt
tctccaggcaatgccactggctgcctgccatgctcatgccatacaactggtgcagttaat
cacatctgtaatagcctgactggtcagtgtgtttgccaagatgcttccattgctgggcaa
cgttgtgaccaatgcaaagaccattactttggatttgatcctcagactggaagatgtcag
ccttgtaattgtcatctctcaggagccttgaatgaaacctgtcacttggtcacaggccag
tgtttctgtaaacaatttgtcactggctcaaagtgtgatgcttgtgttcccagtgcaagc
cacttggatgtcaacaatctattgggttgcagcaaaactccattccagcaacctccgccc
agaggacaagttcaaagttcttctgctatcaatctctcctggagtccacctgattctcca
aatgcccactggcttacttacagtttactcagggatggttttgaaatctacacaacagag
gatcaatacccatacagtattcaatacttcttagacacagacctgttaccatataccaaa
tattcctattacattgagaccaccaatgtgcatggttcaacaaggagtgtagctgtcact
tacaagacaaaaccaggggtcccagagggaaacttgactttaagttatatcattcctatt
ggctcagactctgtgacacttacctggacaacactctcaaatcaatctggtcccatagag
aaatatattttgtcctgtgcccctttggctggtggtcagccatgtgtttcctacgaaggt
catgaaacctcagctaccatctggaatctggttccatttgccaagtacgatttttctgta
caggcgtgtactagcgggggctgtttacacagcttgcccattacagtgaccacagcccag
gcccctccccaaagactaagtccacctaagatgcagaaaatcagttctacagaacttcat
gtagaatggtctccaccagcggaactaaatggaataattataagatatgaactatacatg
agaagactgagatctactaaagaaaccacatctgaggaaagtcgagtttttcagagcagt
ggttggctcagtcctcattcatttgtagaatcggccaatgaaaatgcattaaaacctcct
caaacaatgacaaccatcactggcttggagccatacaccaagtatgagttcagagtctta
gctgtgaatatggctggaagtgtgtcttctgcctgggtctcagaaagaacgggagaatca
gcacctgtattcatgatccctccttcagtctttcccctctcttcgtactctctcaatatc
tcctgggagaagccagcagataatgttacaagaggaaaagttgtggggtatgacatcaat
atgctttctgaacaatcacctcaacagtctattcccatggcgttttcacagctgttgcac
actgctaaatcccaagaactatcttacactgtagaaggactgaaaccttataggatatat
gagtttactattactctctgcaattcagttggttgtgtgaccagtgcttcgggagcagga
caaactttagcagcagcaccagcacaactgaggccacctctggttaaaggaatcaacagc
acaacaatccatcttaagtggtttccacctgaagaactgaatggaccctctcctatatat
cagctggaaaggagagagtcatctctaccagctctgatgaccacgatgatgaaaggaatc
cgtttcataggaaatgggtattgtaaatttcccagctccactcacccagtcaatacagac
ttcactggcattaaggccagctttcgaacaaaagtgcctgaaggtttgattgtctttgca
gcatcacctggcaatcaggaagagtattttgcacttcagttgaagaagggacgtctttat
tttctttttgatcctcaggggtcaccagtggaagtaactacaactaatgatcatggcaaa
caatatagtgatggaaaatggcatgaaataattgctattaggcatcaggcttttggccaa
atcactctggatgggatatatacaggttcctctgccatcctgaatggtagtactgttatt
ggagataacacaggagtctttctgggagggctcccgcgaagttataccatcctcaggaag
gatcctgagataatccaaaaaggttttgtgggctgtctcaaggatgtacattttatgaag
aattacaatccgtcagctatttgggaacctctggattggcagagttctgaagaacaaatc
aacgtgtataacagctgggagggatgtcccgcttcattaaatgagggagctcagttccta
ggagcagggttcctggaacttcatccatatatgtttcatggtggaatgaactttgagatt
tcctttaagttcagaactgaccaattaaatggattgcttcttttcgtttataacaaagat
ggacctgattttcttgctatggagctgaaaagtggaatattgaccttccggttaaatacc
agtcttgcctttacacaagtggatctattgctggggctatcctattgtaatggaaagtgg
aataaagtcattattaaaaaggaaggctctttcatatcagcaagtgtgaatggactgatg
aagcatgcatcggagtccggagaccagccactggtggtgaattcaccagtttatgtggga
ggaatcccacaggaactgctgaactcttatcaacatttgtgtttggaacaaggtttcggt
ggttgcatgaaggatgttaaatttacacggggtgctgtcgttaacttggcatctgtgtcc
agcggtgctgtcagagtcaatctggatggatgcctatcaactgacagtgctgttaactgc
aggggaaatgactccatcctggtttaccagggaaaagagcagagtgtttacgagggtggt
ctccagccttttacagaatacctgtatcgagtgatagcctcgcatgaaggaggttcagta
tatagtgattggagtcgaggacgtacaacaggagcagctccacaaagtgtgccaactccc
tcaagagtccgcagcttaaatggatacagcattgaggtgacctgggatgaacctgttgtc
agaggtgtaattgagaagtacattctgaaagcctatagtgaggacagcacccgtccaccc
cgcatgccctctgccagtgctgaatttgtcaatacaagcaacctcacaggcatattgaca
ggcttgctacccttcaaaaactatgcagtaaccctaactgcttgcactttggctggctgt
actgagagctcacatgcattgaacatctctactccacaagaagccccacaagaggttcag
ccaccagtagccaaatcccttcccagttctttgctgctctcctggaacccacccaaaaag
gcaaatggtattataactcagtactgtttatacatggatgggaggctgatctattcaggc
agtgaggagaactacacagtcacagatttagcagtatttacaccccaccagtttctacta
agtgcatgcacacatgtgggctgtacaaacagttcctgggtcctactgtacacagcacag
ctgccaccagaacacgtggattccccagttctgactgtcctggattctagaactatacac
atacagtggaaacaaccaagaaaaataagtgggattctggaacgctatgtattatatatg
tcaaaccatacacatgattttacaatttggagtgtcatctataacagtacagaacttttc
caggatcatatgctacaatacgttttacctggtaataaatatctcatcaagctgggagct
tgcacaggtggtgggtgcacagtgagtgaggccagtgaggccctaactgacgaggacata
cccgaaggcgtgccagcccccaaagcccactcatattcacctgactcctttaatgtctcc
tggactgagcctgaatatccgaatggtgttatcacgagttatggattatatctagatggt
atattaatccacaattcctcagaactcagctatcgtgcttacggatttgctccttggagt
ttacattccttcagagtccaagcatgcacggccaaaggttgtgctctgggcccactggtg
gaaaatcgaactctagaagctcctcctgaaggaacagtaaatgtgtttgtcaaaacacag
ggatcccggaaagcccacgtgaggtgggaagcaccttttcgccctaatggactcttaaca
cactcagtccttttcactgggatattctatgtagacccagtaggtaataactacaccctt
ctgaatgtcacaaaagtcatgtacagcggagaagagacaaacctttgggtgctcatcgat
gggctggttccttttaccaactatactgtacaagtgaatatttcaaatagccaaggcagc
ttgataactgatcctataacaattgcaatgcctccaggagctccagatggcgtgctgcct
cccaggctttcatctgccactccaaccagtcttcaggttgtctggtctacaccagctcgt
aataacgctcctggctctcccagataccaactccagatgaggtctggcgactccacccat
ggatttctagagttattttccaatccttctgcatcgttaagctatgaagtgagtgatctc
caaccgtacacagagtatatgtttcggttggttgcctccaatggatttggcagtgcacat
agttcttggattccattcatgaccgcagaggacaaacctggacctgtagttcctccgatt
cttctggatgtgaagtcaagaatgatgttggtcacctggcagcatcctagaaaatccaat
ggggttattacccattataacatttatctacatggccgtctatacttgagaactcctgga
aatgtcactaattgcacagtgatgcatttacacccatacactgcctataagtttcaggta
gaagcctgcacttcaaaaggatgttccctttcaccagagtcccagactgtatggacactc
ccaggggcaccggaagggatcccaagtccagagctgttctctgatactccaacatctgtg
attatatcttggcaaccccctacccaccccaatggcttggtggagaatttcacaattgag
agaagagtcaaaggaaaggaagaagttactaccctggtgactctcccgaggagtcattcc
atgaggtttattgacaagacttctgctcttagcccatggacaaaatatgaatatcgggta
ctgatgagcactcttcatggaggcacaaacagcagtgcttgggtagaagttaccacaaga
ccctcacgacctgctggggtgcagccacctgtggtgacagtgctggaacccgatgcagtc
caggtcacttggaaacccccactcatccagaacggagacatacttagctatgagattcac
atgcctgaccctcacatcactttaaccaatgtgacttccgcagtgttaagtcaaaaagtt
actcatctgattcctttcactaattattctgtcaccattgttgcttgctcagggggtaat
gggtaccttggagggtgcacagagagtttacctacctatgttaccactcaccccaccgta
cctcagaatgttggcccattgtctgtgattccactaagtgaatcatatgttgtgatttct
tggcaaccaccatccaagccaaatggacctaatttgagatatgagcttctgagacgtaaa
atccagcagccacttgcatcaaatcccccagaagatttaaatcggtggcacaatatttat
tcaggaactcagtggctttatgaagataagggtcttagcaggtttacaacctatgaatat
atgctcttcgtacacaacagtgtgggttttacaccgagccgagaagtgactgtgacaacg
ttagctggtcttccagagagaggagccaatctcactgcgagtgtccttaaccacacagcc
atcgacgtgaggtgggctaaaccaactgttcaagacctacaaggtgaagttgaatattac
acacttttttggagttctgctacctcaaacgactctctaaaaatcttgccagatgtaaac
tctcatgtcattggccacctaaagccaaacacagagtattggatctttatctctgtcttc
aatggagtccacagcatcaacagtgcaggacttcatgcaaccacttgcgatggggagcct
cagggcatgcttcctccagaggttgtcatcatcaacagtacagctgtacgtgtcatctgg
acatctccttcaaacccaaatggtgttgtcactgagtattctatctatgtaaataataag
ctctacaagactggaatgaatgtgcctgggtcgtttattctgagagacctgtctcccttc
actatctatgacattcaggttgaagtctgcacaatatatgcctgcgtgaaaagcaatgga
acccaaattaccactgtggaagacactccaagtgatataccaacacccacaattcgtggc
atcacttcaagatctcttcaaattgattgggtgtctccacggaagccaaatggcatcatt
cttggatatgatctcctatggaaaacatggtatccatgcgctaaaactcaaaagttagtg
caggatcagagtgatgagctctgcaaggcagtgaggtgtcaaaaacctgaatctatctgt
ggacacatttgctattcttctgaagctaaggtttgttgtaacggagtgctctataacccc
aagcctggacatcgctgttgtgaagaaaagtatatcccgtttgttctgaattctactgga
gtttgttgtggtggccgaatacaggaggcacaaccaaatcatcagtgctgctctgggtat
tacgctagaattctaccaggtgaagtatgctgtccagatgaacagcacaatcgggtttct
gttggcattggtgattcctgctgtggcagaatgccgtactccacctcaggaaaccagatt
tgctgtgctgggaggcttcatgatggccatggccagaagtgctgtggcagacagattgtg
agcaacgatttagagtgttgtggtggagaagaaggagtggtgtacaatcgccttccaggt
atgttctgttgtgggcaggattatgtgaatatgtcagataccatatgctgctcagcttcc
agtggagagtctaaagcacatattaaaaagaatgacccggtgccagtaaaatgctgtgag
actgaacttattccaaagagccagaaatgctgtaatggagttggatataatcctttgaaa
tatgtttgctctgacaagatttcaactggaatgatgatgaaggaaaccaaagagtgcagg
atcctctgcccagcatctatggaagccacagaacattgtggcaggtgtgacttcaacttt
accagccacatttgcactgtgataagagggtctcacaattccacagggaaggcatcaatt
gaagaaatgtgttcatctgccgaagaaaccattcatacagggagtgtaaacacgtactct
tacacagatgtgaacctcaagccctacatgacatatgagtacaggatttctgcctggaac
agctatgggcgaggactcagcaaagctgtgagagccagaacaaaagaagatgtgcctcaa
ggagtgagtccccctacgtggaccaaaatagacaatcttgaagatacaattgtcttaaac
tggagaaaacctatacaatcaaatggtcctattatttactacatccttcttcgaaatgga
attgaacgttttcggggaacatcactgagcttctctgataaagagggaattcaaccattt
caggaatattcatatcagctgaaagcttgcacggttgctggctgtgccaccagtagcaag
gtagttgcagctactacccaaggagttccggagagcatcctgccaccaagcatcacagcc
ctaagtgcagtggctctgcatctgagctggagtgtccctgagaaatcaaacggcgtcatt
aaagagtaccagatcaggcaggttgggaaaggtctcatccacactgacaccactgacagg
agacagcatacggtcacaggtctccagccatacaccaactacagcttcactcttacagct
tgtacatctgctgggtgcacttcaagcgagccttttctaggtcagacactgcaggcagct
cctgaaggagtttgggtgacacctcgacacattatcatcaattctacaacagtggaatta
tattggagtctgccagaaaagcccaatggcctcgtttctcaatatcaattgagtcgtaat
ggaaacttgcttttcctgggtggcagtgaggagcagaatttcactgataaaaacctggag
cccaatagcagatacacttacaagttagaagtcaaaactggaggtggcagcagtgctagt
gatgattacattgttcaaacacctatgtcaacaccagaagaaatctatcctccatataat
atcacagtaattgggccttattctatatttgtagcttggataccaccagggatcctcatc
cccgaaattcctgtggagtacaatgtcttactcaatgatggaagtgtaacacctctggcc
ttctccgttggtcatcatcaatccacccttctggaaaatttgactccattcacacagtat
gagataaggatacaagcatgtcaaaatggaagttgtggagttagcagtaggatgtttgtc
aaaacacctgaagcagccccaatggatcttaattctcctgttcttaaggcactggggtca
gcttgcatagagattaagtggatgccacctgaaaaaccaaatggaatcatcatcaactac
tttatttacagacgccctgctggcattgaagaggagtctgttttatttgtctggtcagaa
ggagcccttgaatttatggatgaaggagacaccctgaggcctttcacactctacgaatat
cgggtcagagcctgtaactccaagggttcagtggagagtctgtggtcattaacacaaact
ctggaagctccacctcaagattttccagctccttgggctcaagccacgagtgctcattca
gttctgttgaattggacaaagccagaatctcccaatggcattatctcccattaccgtgtg
gtctaccaggagagacccgacgatcctacatttaacagccctaccgtgcatgctttcaca
gtgaagggaacaagccatcaagcccacctgtacgggttagaaccattcacaacatatcgc
attggtgttgtggctgcaaaccatgcaggagaaattttaagcccttggactctgattcaa
accttagaatcttccccaagtggactgagaaactttatagtagaacagaaagagaatggc
cgggcattgctactacagtggtcagaacctatgagaaccaatggtgtgattaagacatac
aacatcttcagtgacgggttcctggagtactctggtttgaatcgtcagtttctcttccgc
cgcctggatcctttcactctctacacactgaccctggaggcctgcaccagagcaggttgt
gcacactcggcgcctcagcctctgtggacagatgaagcccctccagactctcagctggct
cctactgtccactctgtgaagtccaccagtgttgagctgagctggtctgagcctgttaac
ccaaatggaaaaataattcgctatgaagtgattcgcagatgcttcgagggaaaagcttgg
ggaaatcagacgatccaggccgacgagaaaattgttttcacagaatataacactgaaagg
aatacatttatgtataatgacacaggtttgcaaccatggacgcagtgtgaatataaaatc
tacacttggaattcagctgggcatacctgtagctcttggaatgtggtgaggacattgcaa
gcacctccagaaggtctctctccacctgtgatatcctatgtttctatgaatccccaaaaa
ctgctgatttcctggatcccaccagaacagtctaatggtattatccagtcctataggctt
caaaggaatgaaatgctctatccttttagctttgatcctgtgactttcaattacactgat
gaagagcttcttcctttttccacctatagctatgcactccaagcctgcacgagtggagga
tgctccaccagcaaacccaccagcatcacaactctggaggctgctccatcagaagtcagc
cctccagatctttgggccgtcagtgccactcaaatgaatgtatgttggtcaccgcccaca
gtgcaaaatggaaagattactaaatatttagttagatatgataataaagagtcccttgct
ggccagggcctgtgcctgctggtttcccacctgcagccttactctcagtataacttctcc
cttgtagcctgcacgaatggaggttgcacagctagtgtgtcaaaatctgcctggacaatg
gaggccctgccagagaacatggactctccaacattgcaagtcacaggctcagaatcaata
gaaatcacctggaaacctccaagaaacccaaatggccagatcagaagttatgaacttagg
agggatggaaccattgtatatacaggcttggaaacacgctatcgtgattttactctcacc
ccaggtgtggagtatagctacacagtaactgccagcaacagccaagggggtattttgagt
cctcttgtcaaagatcgaaccagcccctcagcaccctcagggatggaacctccaaaattg
caggccaggggtcctcaggagatcttagtgaactgggaccctccagtgagaacaaatggt
gatatcatcaattataccctcttcatccgtgaactatttgaaagagaaactaaaatcata
cacataaacacaactcataattcttttggtatgcagtcatatatagtaaaccagctgaag
ccatttcacaggtatgaaatacgaattcaagcgtgcaccaccctgggatgtgcatcaagt
gactggacattcatacagacccctgagattgcacctttgatgcaaccccctccacatctg
gaggtacaaatggctccaggaggattccagccaactgtttctcttttgtggacaggaccg
ctgcagccaaatggaaaagttttgtattacgaattatacagaagacaaatagcaactcag
cctagaaaatccaatccagtcctaatctataacggaagctcaacatcttttatagattcc
gaactattgcctttcacagagtatgagtatcaggtctgggcagtgaattctgcaggaaaa
gcccccagtagctggacatggtgcagaaccgggccagccccaccagaaggtctcagagcc
cccacgttccatgtgatctcttctacccaagcagtggtcaacatcagtgcccctgggaag
cccaacgggatcgtcagtctctacaggctgttctccagcagcgcccatggggctgagaca
gtgctatccgaaggcatggccacccagcagactctccatggccttcaagccttcactaac
tactctattggagtagaggcctgcacctgcttcaactgttgcagcaaaggaccgacagct
gaactgagaacccatcctgccccaccctcaggactgtcctctccacaaatcgggacgctg
gcctcaaggacggcctccttccggtggagtccccccatgttccccaatggtgtcattcac
agctatgaactccaattccacgtggcttgccctcctgactcagccctcccctgtactccc
agccaaatagaaacaaagtacacggggctggggcagaaagccagccttgggggtctccag
ccctacaccacatacaagctgagagtggtggcacacaacgaggtgggcagtacggcttcc
gagtggatcagtttcaccacccaaaaagaattgcctcagtaccgagccccattttcggtg
gacagcaatttgtctgtggtgtgtgtgaactggagtgacaccttcctcctgaacggccaa
ctgaaggagtacgtgttaaccgacggagggcgacgcgtgtacagcggcttggacaccacc
ctctacataccgagaacggcggacaaaaccttctttttccaggtcatctgcacgactgac
gaaggaagtgttaagacgccgttgatccaatatgatacctctactggacttggcttggtc
ctaacaactcctgggaaaaagaagggatcgcggagcaaaagcacagagttctacagcgag
ctgtggttcatagtgttaatggcgatgctgggcttgatcttgttggccatttttctgtcc
ctgatactacaaagaaaaatccacaaagagccatatatcagagaaagacctcccttggta
cctcttcagaagaggatgtctccattgaatgtttacccaccgggggaaaaccatatgggg
ttagccgataccaaaattccccggtctgggacacctgtgagtatccgcagcaaccggagt
gcatgtgtcctgcgcatcccgagtcaaaaccaaaccagcctaacctactcccagggttct
cttcaccgcagcgtcagccagctcatggacattcaagacaagaaagtcttgatggacaac
tcactgtgggaagccatcatgggccacaacagtggactgtatgtggatgaagaggacctg
atgaacgccatcaaggatttcagctcagtgactaaggaacgcaccacattcacagacacc
cacctgtaa

DBGET integrated database retrieval system