KEGG   Homo sapiens (human): 7403Help
Entry
7403              CDS       T01001                                 

Gene name
KDM6A, KABUK2, UTX, bA386N14.2
Definition
lysine (K)-specific demethylase 6A
Orthology
K11447  
histone demethylase [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    7403 (KDM6A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     7403 (KDM6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.2
AA seq 1453 aa AA seqDB search
MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFV
RFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYY
SLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVN
TDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQ
VKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKV
QDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGT
LYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIE
EAWSLPIPAELTSRQGAMNTAQQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDD
LSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLN
PAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALT
RVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVP
YLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQH
LQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVP
ETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKA
NNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPH
SGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGL
SNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVT
VIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRS
HTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNI
DLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQE
NNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVY
RFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIV
PMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPA
HYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYD
QFTLAPPLPSASS
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctgcggagtgtcgctcgctaccgccgccgctgccgccgccgctttcggtgat
gaggaaaagaaaatggcggcgggaaaagcgagcggcgagagcgaggaggcgtcccccagc
ctgacagccgaggagagggaggcgctcggcggactggacagccgcctctttgggttcgtg
agatttcatgaagatggcgccaggacgaaggccctactgggcaaggctgttcgctgctat
gaatctctaatcttaaaagctgaaggaaaagtggagtctgatttcttttgtcaattaggt
cacttcaacctcttattggaagattatccaaaagcattatctgcataccagaggtactac
agtttacagtctgactactggaagaatgctgcctttttatatggtcttggtttggtctac
ttccattataatgcatttcagtgggcaattaaagcatttcaggaggtgctttatgttgat
cccagcttttgtcgagccaaggaaattcatttacgacttgggcttatgttcaaagtgaac
acagactatgagtctagtttaaagcattttcagttagctttggttgactgtaatccctgc
actttgtccaatgctgaaattcaatttcacattgcccacttatatgaaacccagaggaaa
tatcattctgcaaaagaagcttatgaacaacttttgcagacagagaatctttctgcacaa
gtaaaagcaactgtcttacaacagttaggttggatgcatcacactgtagatctcctggga
gataaagccaccaaggaaagctatgctattcagtatctccaaaagtccttggaagcagat
cctaattctggccagtcctggtatttcctcggaaggtgctattcaagtattgggaaagtt
caggatgcctttatatcttacaggcagtctattgataaatcagaagcaagtgcagataca
tggtgttcaataggtgtgctatatcagcagcaaaatcagcccatggatgctttacaggcc
tatatttgtgctgtacaattggaccatggccatgctgcagcctggatggacctaggcact
ctctatgaatcctgcaaccagcctcaggatgccattaaatgctacttaaatgcaactaga
agcaaaagttgtagtaatacctctgcacttgcagcacgaattaagtatttacaggctcag
ttgtgtaaccttccacaaggtagtctacagaataaaactaaattacttcctagtattgag
gaggcgtggagcctaccaattcccgcagagcttacctccaggcagggtgccatgaacaca
gcacagcaggcatgtaaacctcatcatccaaatactgaacctgtattaggcctcagtcaa
acaccaatttcacagcaatccttgccactacacatgattccttctagccaagtagatgac
ctgtccagtcctgccaagaggaaaagaacatctagtccaacaaagaatacttctgacaat
tggagtggtggacatgctgtgtcacatcctccagtacagcaacaagctcattcatggtgt
ttgacaccacagaaattacagcatttggaacagctccgcgcaaatagaaataatttaaat
ccagcacagaaactgatgctggaacagctggaaagtcagtttgtcttaatgcaacaacac
caaatgagaccaacaggagttgcacaggtacgatctactggaattcctaatgggccaaca
gctgactcatcactgcctacaaactcagtctctggccagcagccacagcttgctctgacc
agagtgcctagcgtctctcagcctggagtccgtcctgcctgccctgggcagcctttggcc
aatggacccttttctgcaggccatgttccctgtagcacatcaagaacgctgggaagtaca
gacactattttgataggcaataatcatataacaggaagtggaagtaatggaaacgtgcct
tacctgcagcgaaacgcactcactctacctcataaccgcacaaacctgaccagcagcgca
gaggagccgtggaaaaaccaactatctaactccactcaggggcttcacaaaggtcagagt
tcacattcggcaggtcctaatggtgaacgacctctctcttccactgggccttcccagcat
ctccaggcagctggctctggtattcagaatcagaacggacatcccaccctgcctagcaat
tcagtaacacagggggctgctctcaatcacctctcctctcacactgctacctcaggtgga
caacaaggcattaccttaaccaaagagagcaagccttcaggaaacatattgacggtgcct
gaaacaagcaggcacactggagagacacctaacagcactgccagtgtcgagggacttcct
aatcatgtccatcagatgacggcagatgctgtttgcagtcctagccatggagattctaag
tcaccaggtttactaagttcagacaatcctcagctctctgccttgttgatgggaaaagcc
aataacaatgtgggtactggaacctgtgacaaagtcaataacatccacccagctgttcat
acaaagactgataactctgttgcctcttcaccatcttcagccatttcaacagcaacacct
tctccaaaatccactgagcagacaaccacaaacagtgttaccagccttaacagccctcac
agtgggctacacacaattaatggagaagggatggaagaatctcagagccccatgaaaaca
gatctgcttctggttaaccacaaacctagtccacagatcataccatcaatgtctgtgtcc
atataccccagctcagcagaagttctgaaggcatgcaggaatctaggtaaaaatggctta
tctaacagtagcattttgttggataaatgtccacctccaagaccaccatcttcaccatac
cctcccttgccaaaggacaagttgaatccacctacacctagtatttacttggaaaataaa
cgtgatgctttctttcctccattacatcaattttgtacaaatccgaacaaccctgttaca
gtaatacgtggccttgctggagctcttaagttagacctgggacttttctctactaaaact
ttggtggaagctaacaatgaacatatggtagaagtgaggacacagttgttgcagccagca
gatgaaaactgggatcccactggaacaaagaaaatctggcattgtgaaagtaatagatct
catactacaattgctaaatatgcacagtaccaggcctcctcattccaggaatcattgaga
gaagaaaatgaaaaaagaagtcatcataaagaccactcagatagtgaatctacatcgtca
gataattctgggaggaggaggaaaggaccctttaaaaccataaagtttgggaccaatatt
gacctatctgatgacaaaaagtggaagttgcagctacatgagctgactaaacttcctgct
tttgtgcgtgtcgtatcagcaggaaatcttctaagccatgttggtcataccatattgggc
atgaacacagttcaactatacatgaaagttccagggagcagaacaccaggtcatcaggaa
aataacaacttctgttcagttaacataaatattggcccaggtgactgtgaatggtttgtt
gttcctgaaggttactggggtgttctgaatgacttctgtgaaaaaaataatttgaatttc
ctaatgggttcttggtggcccaatcttgaagatctttatgaagcaaatgttccagtgtat
aggtttattcagcgacctggagatttggtctggataaatgcaggcactgttcattgggtt
caggctattggctggtgcaacaacattgcttggaatgttggtccacttacagcctgccag
tataaattggcagtggaacggtacgaatggaacaaattgcaaagtgtgaagtcaatagta
cccatggttcatctttcctggaatatggcacgaaatatcaaggtctcagatccaaagctt
tttgaaatgattaagtattgtcttctaagaactctgaagcaatgtcagacattgagggaa
gctctcattgctgcaggaaaagagattatatggcatgggcggacaaaagaagaaccagct
cattactgtagcatttgtgaagtggaggtttttgatctgctttttgtcactaatgagagt
aattcacgaaagacctacatagtacattgccaagattgtgcacgaaaaacaagcggaaac
ttggaaaactttgtggtgctagaacagtacaaaatggaggacctgatgcaagtctatgac
caatttacattagctcctccattaccatccgcctcatcttga

DBGET integrated database retrieval system