KEGG   Homo sapiens (human): 7407Help
Entry
7407              CDS       T01001                                 

Gene name
VARS, G7A, VARS1, VARS2
Definition
valyl-tRNA synthetase (EC:6.1.1.9)
Orthology
K01873  
valyl-tRNA synthetase [EC:6.1.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    7407 (VARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     7407 (VARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   7407 (VARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    7407 (VARS)
 Prokaryotic Type
    7407 (VARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 1264 aa AA seqDB search
MSTLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPAL
EQGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPA
RRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPEAPALPKTAAQLKKEAKK
REKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITYDLPTPPGEKKDVSGPMPDSY
SPRYVEAAWYPWWEQQGFFKPEYGRPNVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAI
QDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLQEVWKWK
EEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGIIYRSTRLVNWSCT
LNSAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIET
MLGDVAVAVHPKDTRYQHLKGKNVIHPFLSRSLPIVFDEFVDMDFGTGAVKITPAHDQND
YEVGQRHGLEAISIMDSRGALINVPPPFLGLPRFEARKAVLVALKERGLFRGIEDNPMVV
PLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHAWMDNIREWC
ISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFGVSPDKISL
QQDEDVLDTWFSSGLFPLSILGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKL
TGRLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVE
KAKEGQKADFPAGIPECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFA
LRGLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLY
ELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMP
QAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVAD
EATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARE
LGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALF
QKML
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctctacgtctcccctcacccagatgccttccccagcctccgagccctcata
gccgctcgctatggggaggctggggagggtcccggatggggaggagcccacccccgcatc
tgtctccagccacccccgactagcaggactccctttcccccaccccgcctgccggccctg
gagcaggggcccggtgggctctgggtgtggggggccacggctgtggcccagctgctgtgg
ccagcaggcctggggggcccagggggcagccgggcggctgtccttgtccaacagtgggtc
agttacgccgacacggagttaataccagctgcctgtggagcaacgctgccggccctggga
ctccgaagctcggcccaggacccccaggctgtgctgggggccctgggcagggccctgagc
cccttggaggagtggcttcggctgcacacctacttggccggggaggcccccactctggct
gacctggcggctgtcacagccttgctgctgcctttccgatacgtcctagacccacctgcc
cgccggatctggaataatgtgactcgctggtttgtcacgtgtgtccggcagccagaattc
cgagccgtgctaggagaagtggttctatactcaggagccaggcctctctctcatcagcca
ggccccgaggctcctgccctcccaaagacagctgctcagctcaagaaagaggcaaagaaa
cgggagaagctagagaaattccaacagaagcagaagatccaacagcagcagccacctcca
ggggagaagaaaccaaaaccagagaagagggagaaacgggatcctggggtcattacctat
gacctcccaaccccacccggggaaaagaaagatgtcagtggccccatgcccgactcctac
agccctcggtatgtggaggctgcctggtacccttggtgggagcagcagggcttcttcaag
ccagagtatgggcgtcctaatgtgtcagcagcaaatccccgaggtgtcttcatgatgtgc
atcccaccccccaatgtgacaggctccctgcacctgggccatgcactcaccaacgccatc
caggactccctgactcgatggcaccgcatgcgtggggagaccaccctgtggaaccctggc
tgtgaccatgcaggtattgccacccaggtggtggtggagaagaagctatggcgtgagcag
ggactgagccggcaccagctgggccgcgaggcctttctacaggaagtctggaagtggaag
gaggagaaaggtgaccggatttaccaccagttgaagaagcttggcagctccttggactgg
gatcgagcctgtttcaccatggaccctaaactctcagcagctgtgacagaggcctttgtc
cggcttcacgaggaaggcatcatctatcgcagtacccgccttgttaactggtcctgcacc
ctcaactccgccatctctgacattgaggtggataagaaggagctgacaggtcgcaccctg
ctctccgtgcctggctacaaggagaaggtggagttcggggtcctcgtgtcctttgcctat
aaggtccaaggctcagatagcgacgaggaggtggtggtggcaacaactcggatcgagaca
atgctgggagatgtggctgtagctgtgcaccccaaagataccagataccagcacctgaag
gggaagaacgtgatccacccattcctgtctcggagccttcccattgtcttcgatgaattt
gtggacatggactttggcacaggtgctgtgaagatcacccccgcacatgaccaaaatgac
tatgaagttgggcagcggcacgggctggaggccatcagcatcatggactcccggggggcc
ctcatcaatgtgcctccgcctttcctgggcctgcccaggtttgaggccaggaaagcggtg
ctggtggcgctgaaggagcggggactgttccgtggcattgaggacaaccccatggtggtg
ccactttgcaaccggtcgaaggacgtggtagagcctctgctgcggccgcagtggtacgtt
cgctgcggggagatggcccaggctgccagcgccgctgtgactcggggtgacctccgcatc
ctgcctgaggcccatcagcgcacatggcatgcctggatggacaacatccgggagtggtgc
atttccaggcagctgtggtggggccatcgcatcccagcctactttgtcactgtcagtgac
ccagcggtgccccctggggaggaccctgatgggcggtactgggtgagtggacgcaatgag
gcggaggcccgggagaaggcagccaaggagttcggagtgtcccctgacaagatcagtctc
cagcaagatgaggatgtattggatacctggttctcctctggcctcttccccttatccatt
ttgggctggcccaaccagtcagaagacctgagtgtgttctaccccgggacactgctggag
accggtcatgacatcctcttcttctgggtggcccggatggtcatgctgggcctgaagctc
acgggcaggctgccctttagagaggtctacctccatgccatcgtgcgagatgctcacggc
cggaagatgagcaagtctctaggcaatgtcatcgatcccctggacgtcatctatggaatc
tccctgcagggcctccacaaccagctgctgaacagcaacctggatcccagcgaggtggag
aaggccaaagaagggcagaaagctgacttcccagcggggattcctgaatgtggcaccgat
gctctccggtttggattatgtgcctacatgtcccagggtcgtgacatcaacctggatgtg
aaccggatactgggttaccgccacttctgcaacaagctctggaatgccaccaagtttgcc
cttcgtggccttgggaagggttttgtgccctcacccacctcccagcccggaggccatgag
agcctggtggaccgctggatccgcagccgcctgacagaggctgtgaggctcagcaatcaa
ggcttccaggcctacgacttcccggccgtcaccactgcccagtacagcttctggctctat
gagctctgtgatgtctacttggagtgcctgaaacctgtactgaatggggtggaccaggtg
gcagctgagtgtgcccgccagaccctgtacacttgcctggacgttggcctgcggctgctc
tcacccttcatgcccttcgtgacggaggagctgttccagaggctgccccggaggatgccg
caagctccccctagcctctgtgttaccccctacccggagccctcagagtgctcctggaag
gaccccgaggcagaagccgcccttgagctggcgctaagcatcacgcgagccgtgcgctcc
ctgcgggccgactacaacctcacccggatccggcctgactgtttcctggaagtggcggat
gaggccacgggcgccctggcatcggcggtgtcgggctacgtgcaggccctggccagcgca
ggtgtggtggctgttctggccctgggggctcccgccccccagggttgcgctgtggctctg
gcttctgatcgctgctccatccacctgcagcttcaggggctggtggaccctgcacgggag
ctgggcaagctgcaagccaagcgagttgaggcccagcggcaggcccagcgtctgcgggaa
cgccgtgctgcctcgggctatcctgtcaaggtgccgctcgaagtccaggaggcagatgaa
gccaagctccaacagacagaagcagagctcaggaaggtggatgaggccatcgccctattc
cagaagatgctgtga

DBGET integrated database retrieval system